close all open/close all
first first   Nanch_00020 Nanch_00020

CDS information : Nanch_00010


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction2,052 / 682 / - [in whole cluster]
2,052 / 682 / - [in contig]
Locationcomplement(682..2052) [in whole cluster]
complement(682..2052) [in contig]
TypeCDS
Length1,371 bp (456 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)NanT1
Gene
Gene (GenBank)nanT1
EC number
Keyword
Note
Note (GenBank)
  • putative integral membrane transport protein
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
P76350
PmId
[9524262] Cloning and analysis of the shiA gene, which encodes the shikimate transport system of escherichia coli K-12. (Gene. , 1998)

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [NanT1]
MHDTTKDDPRASERRSGVRRAFVASLTGTALEWYDFAVYSAAAALVFGDLFFPSEDPLTG
TLLAFSTYAVGYVSRPLGGIVFGRLGDVIGRKKVLIATLVLIGAATFLIGVLPTYSTIGV
AAPIALVVLRFAQGVGVGGEWGGAVLLSSEFGDSRRRGFYASAAQVGPPAGNLLANGVLA
ALGALLTEAQFEAWGWRVAFLLSGALVAFGLWIRAKLEETPVFKAMEAEQSRPEAPIREV
FTTQPRALLAAILCRVGPDVLYAMFTVFVLTYATGELGMSRGSALAAVLIGSSLQVFLMP
LAGAVSDRINRRVLYGCAAVAAGVWPFLFFPMIGGGSWIPLALGVVVGLVIHSFLYGPQA
AFIAEQFSPRLRYTGSSLAYTLAGIIGGAIAPLLFTTLLSAYGSWLPLALYIAVAAAVSL
AGVLLGRDPEAAVDEDAQLATPAAQATADAARPTAV
selected fasta
>putative major facilitator superfamily transporter [NanT1]
ATGCACGACACCACCAAGGACGATCCGAGGGCGTCCGAGAGGCGCTCCGGCGTCCGGCGG
GCCTTTGTCGCGAGCCTGACCGGCACAGCCCTGGAGTGGTACGACTTCGCCGTCTACTCC
GCCGCGGCGGCCCTGGTCTTCGGCGATCTCTTCTTCCCTTCGGAGGACCCGCTCACCGGC
ACGCTGCTGGCCTTCTCCACATACGCGGTCGGCTACGTCTCGCGCCCGCTGGGCGGGATC
GTCTTCGGTCGCCTCGGCGATGTGATCGGCCGCAAGAAGGTGCTGATCGCCACACTGGTC
CTGATCGGCGCGGCCACGTTCCTGATCGGCGTCCTGCCCACGTACTCCACGATCGGGGTC
GCCGCCCCGATCGCCCTGGTCGTGCTGCGGTTCGCGCAGGGCGTGGGCGTCGGCGGCGAG
TGGGGCGGCGCGGTGCTGCTGTCCAGCGAGTTCGGCGACTCGCGCCGCCGCGGTTTCTAC
GCCTCCGCCGCGCAGGTGGGCCCGCCCGCGGGCAACCTCCTGGCCAACGGCGTCCTGGCC
GCCCTCGGCGCGCTGCTGACCGAGGCGCAGTTCGAGGCATGGGGCTGGCGCGTGGCCTTC
CTGCTCTCCGGCGCCCTCGTCGCCTTCGGCCTGTGGATCAGGGCGAAGCTGGAGGAGACC
CCGGTCTTCAAGGCGATGGAGGCCGAGCAGTCCCGGCCCGAGGCGCCGATCCGCGAGGTC
TTCACCACCCAGCCCCGCGCCCTGCTCGCCGCGATCCTCTGCCGCGTCGGCCCCGACGTG
CTGTACGCCATGTTCACCGTCTTCGTCCTGACGTACGCCACCGGAGAACTGGGCATGTCG
CGCGGTTCCGCCCTCGCGGCCGTCCTCATCGGCTCCTCGCTGCAGGTCTTCCTGATGCCG
CTGGCCGGTGCCGTCTCCGACCGGATCAACCGTCGAGTGCTGTACGGCTGTGCCGCGGTG
GCCGCCGGTGTGTGGCCGTTCCTGTTCTTCCCGATGATCGGCGGCGGCAGCTGGATCCCG
CTGGCGCTCGGCGTCGTGGTGGGCCTCGTGATCCACTCCTTCCTGTACGGGCCGCAGGCC
GCCTTCATCGCCGAGCAGTTCTCGCCCCGGCTGCGCTACACCGGCTCATCGCTGGCGTAC
ACCCTGGCCGGGATCATCGGCGGCGCCATCGCCCCGCTGCTGTTCACCACCCTGCTGAGC
GCCTACGGCAGCTGGCTGCCGCTGGCCCTCTACATCGCCGTCGCCGCGGCCGTCTCCCTC
GCGGGGGTGCTCCTGGGCCGCGATCCCGAAGCCGCCGTCGACGAGGACGCCCAGCTCGCC
ACACCGGCCGCGCAGGCCACGGCCGACGCCGCCCGACCCACTGCCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005828 General substrate transporter (Family)
 [21-230]  1.4e-21 PF00083
PF00083   Sugar_tr
IPR011701 Major facilitator superfamily (Family)
 [263-433]  4.80000000000001e-10 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-438]  3.60002015031011e-66 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [21-430]  PS50850
PS50850   MFS
SignalP No significant hit
TMHMM
 [21-43]  Transmembrane (i-o) [63-85]  Transmembrane (o-i) [94-116]  Transmembrane (i-o) [126-148]  Transmembrane (o-i) [161-183]  Transmembrane (i-o) [193-215]  Transmembrane (o-i) [247-269]  Transmembrane (i-o) [284-306]  Transmembrane (o-i) [313-335]  Transmembrane (i-o) [339-356]  Transmembrane (o-i) [377-399]  Transmembrane (i-o) [404-426]  Transmembrane (o-i)
Transmembrane 12   
first first   Nanch_00020 Nanch_00020