close all open/close all

CDS information : Nanch_00020


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction2,064 / 2,879 / + [in whole cluster]
2,064 / 2,879 / + [in contig]
Location2064..2879 [in whole cluster]
2064..2879 [in contig]
TypeCDS
Length816 bp (271 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)NanT2
Gene
Gene (GenBank)nanT2
EC number
Keyword
Note
Note (GenBank)
  • putative ABC transporter
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [NanT2]
MLGGHRPSGILLVYRSYAQALRKKLTAEKSTTADRHPNSGSAPMARLTFELPDGSTREVD
IVQVLNAGYAGRSQDDVAAHIAELAELGVPTPSVTPALYPVAPYLAQQIDRVAVQHRRTS
GEAEWALVVAGDGELLLTAACDHTDRDLEVHGVAWSKNAGPDVLARRAWRLADVEPRLDD
LTLRAWVTRDGTETEIQHGTLAELLTPAYWVDVLRSRDALTPGTVLISGTIPMTPGVDQF
ADTWRVELGDPATGDTIRLAYDVHPMPEPIG
selected fasta
>hypothetical protein [NanT2]
TTGCTCGGGGGACATCGACCTTCCGGCATACTTCTTGTATACAGGTCGTATGCGCAAGCC
CTGCGCAAGAAGTTAACCGCGGAGAAATCCACCACCGCGGACCGTCACCCGAACTCTGGG
AGTGCCCCCATGGCCCGCCTGACCTTCGAACTGCCGGACGGATCGACACGCGAGGTCGAC
ATCGTCCAGGTCCTCAACGCCGGGTACGCCGGGCGCAGCCAGGACGACGTCGCCGCACAC
ATCGCCGAACTCGCCGAGCTCGGCGTACCCACCCCCTCCGTGACCCCGGCCCTCTACCCC
GTCGCCCCCTACCTCGCCCAGCAGATCGACCGCGTCGCGGTCCAGCACCGGCGCACCTCC
GGCGAGGCCGAGTGGGCGCTCGTCGTGGCGGGCGACGGCGAGCTGCTGCTCACGGCCGCC
TGCGACCACACCGACCGCGACCTCGAGGTGCACGGCGTGGCCTGGAGCAAGAACGCCGGC
CCCGACGTCCTCGCCCGCCGTGCCTGGCGGCTCGCCGACGTCGAACCACGTCTGGACGAC
CTCACCCTGCGCGCCTGGGTCACCCGCGACGGCACCGAGACCGAGATCCAGCACGGCACC
CTCGCCGAACTCCTCACCCCCGCCTACTGGGTCGACGTCCTGCGCTCCCGCGACGCCCTC
ACCCCAGGCACCGTCCTCATCTCCGGCACCATCCCCATGACCCCGGGTGTCGACCAGTTC
GCCGACACCTGGCGCGTGGAACTGGGCGACCCCGCCACCGGCGACACCATCCGCCTCGCC
TACGACGTGCACCCCATGCCGGAACCCATCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011234 Fumarylacetoacetase, C-terminal-related (Domain)
 [135-248]  0.00012 G3DSA:3.90.850.10
G3DSA:3.90.850.10   Fumarylacetoacetase_C-rel
IPR021269 Protein of unknown function DUF2848 (Family)
 [67-261]  1.10000000000001e-74 PF11010
PF11010   DUF2848
SignalP
 [1-20]  0.433 Signal
Bacteria, Gram-negative   
TMHMM No significant hit