close all open/close all

CDS information : Nanch_00030


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction3,117 / 3,818 / + [in whole cluster]
3,117 / 3,818 / + [in contig]
Location3117..3818 [in whole cluster]
3117..3818 [in contig]
TypeCDS
Length702 bp (233 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative two-component system response regulator
Product (GenBank)NanT3
Gene
Gene (GenBank)nanT3
EC number
Keyword
Note
Note (GenBank)
  • putative two-component response regulator
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q9RIM0
PmId
[16272382] Identification of a novel two-component system SenS/SenR modulating the production of the catalase-peroxidase CpeB and the haem-binding protein HbpS in Streptomyces reticuli. (Microbiology. , 2005)
ACC
Q9RPE9
PmId
[10464204] Identification of a two-component signal transduction system from Corynebacterium diphtheriae that activates gene expression in response to the presence of heme and hemoglobin. (J Bacteriol. , 1999)

close this sectionSequence

selected fasta
>putative two-component system response regulator [NanT3]
MSTRCTGSLTNGWVSVELGIPLSVVLVDDHPVVRAGISAWCAAADAPISVVAEGANVSVA
LHGPGRGADVVVMDLLLQNGRPAYDELQELVAQERKVVVYTMRDSQDAALTCMDLGSATY
ITKAEGQRHLVKAIRAAAEDIPYTPPSLAGAFGSDTRQSRPVLSVREVEVLVEWFQSESK
AVVAQSLGISERTVNTYLDRVRIKYANAGRPATTKAKLVARAVQDGLIALDEL
selected fasta
>putative two-component system response regulator [NanT3]
TTGTCTACTCGTTGTACAGGTTCTCTCACGAATGGGTGGGTGAGTGTGGAGTTAGGAATT
CCCCTCAGCGTCGTGTTGGTCGATGATCACCCCGTGGTGCGCGCGGGCATCTCGGCGTGG
TGTGCCGCCGCCGACGCACCGATCAGCGTGGTCGCCGAGGGGGCGAACGTGTCGGTGGCC
CTCCATGGTCCGGGCCGGGGGGCGGATGTCGTGGTCATGGATCTGTTGTTGCAGAACGGG
CGGCCCGCGTACGACGAGTTGCAGGAGCTCGTGGCCCAGGAGCGCAAGGTCGTCGTCTAC
ACCATGCGGGACAGCCAGGATGCGGCGTTGACCTGCATGGATCTGGGCTCGGCTACCTAC
ATCACCAAGGCGGAGGGGCAGCGGCACCTGGTCAAGGCGATCCGGGCCGCCGCCGAGGAC
ATCCCCTATACACCCCCGTCCCTGGCCGGCGCGTTCGGCAGCGACACCCGGCAGAGCCGC
CCCGTGCTGTCCGTACGGGAGGTGGAGGTGCTGGTGGAGTGGTTCCAGTCCGAGTCGAAG
GCGGTGGTCGCCCAGAGCCTGGGGATCTCGGAGCGCACGGTGAACACCTATCTGGACCGG
GTGCGCATCAAGTACGCGAACGCCGGCCGGCCGGCGACCACGAAGGCCAAGCTGGTGGCC
AGGGCGGTTCAGGACGGTCTGATAGCTCTGGACGAGCTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [160-222]  9.49999985106438e-06 SM00421
SM00421   HTH_LUXR
 [161-202]  5.5e-08 PF00196
PF00196   GerE
IPR001356 Homeodomain (Domain)
 [156-212]  0.00199999965421632 SM00389
SM00389   HOX
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [23-138]  PS50110
PS50110   RESPONSE_REGULATORY
 [22-134]  6.20000124972815e-11 SM00448
SM00448   REC
 [24-135]  1.5e-11 PF00072
PF00072   Response_reg
IPR011006 CheY-like superfamily (Domain)
 [21-142]  1e-13 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [139-228]  1.7e-13 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [141-232]  7.40000780398342e-10 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit