close all open/close all

CDS information : Nanch_00040


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction4,923 / 3,724 / - [in whole cluster]
4,923 / 3,724 / - [in contig]
Locationcomplement(3724..4923) [in whole cluster]
complement(3724..4923) [in contig]
TypeCDS
Length1,200 bp (399 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)NanT4
Gene
Gene (GenBank)nanT4
EC number
Keyword
Note
Note (GenBank)
  • hypothetical chemoreceptor
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [NanT4]
MGEDFRQLITRHQLRGIRAGGLVILVTLHIGSALPGLLGGLGEYRHPWIPLAAYGLLTLI
LGGSVVLGLDGRPWPRGWVPCALAGTFVASVATTSQVPADHYFVSSLHWSYSLAGWFTVV
LLGHRGPLVSGAFLGAHLAVTAALLLTVDVPSRSIGASMALSALSAGCFQMTIAAGAKLL
LDSSAAIGQALRAQERVRTRIAVARQIQADQRRRYAELNATVLPLLTGLASGSLDPEDDE
VRHACALEAARLRRLFAESDCTFDPLVHEMRACIDVAERNGTTVQLAVRGDPLELPLPLR
RALLDPVIAALAAAGQTARVTVVRGGDQVRVGVVVDALRDRLPEPKANGIRVRTVHAEDR
LLVEAACRITARPELSDRPEPPWPPAWPSWSPAGRRSRT
selected fasta
>hypothetical protein [NanT4]
GTGGGTGAGGACTTCCGGCAGCTGATCACCCGTCACCAGCTCCGTGGCATCCGCGCCGGG
GGGCTGGTCATCCTGGTCACTCTGCACATCGGGTCCGCGCTGCCCGGCCTGCTGGGCGGC
CTGGGCGAATACCGGCACCCCTGGATCCCCCTGGCCGCCTACGGCCTGCTCACGCTGATC
CTCGGCGGCAGCGTGGTTCTCGGCCTCGACGGGCGCCCCTGGCCGCGCGGCTGGGTGCCA
TGCGCGCTGGCCGGCACCTTCGTCGCCTCGGTGGCCACCACCAGCCAGGTCCCGGCGGAC
CACTACTTCGTCAGCTCCTTGCACTGGTCCTACTCGCTCGCGGGCTGGTTCACCGTCGTC
CTGCTCGGCCACCGAGGACCGCTGGTGTCCGGCGCCTTCCTCGGCGCTCATCTGGCCGTC
ACCGCCGCCCTGTTGCTGACCGTCGACGTGCCCTCGCGGTCCATCGGGGCGAGCATGGCC
CTGAGCGCCCTGTCCGCCGGCTGCTTCCAGATGACCATCGCCGCCGGCGCCAAGCTGCTC
CTCGACAGCAGCGCGGCCATCGGCCAGGCCCTGCGGGCCCAGGAGCGGGTACGCACCCGT
ATCGCAGTCGCCCGGCAGATCCAGGCGGACCAGCGCCGCCGGTACGCCGAGCTGAACGCC
ACCGTGCTCCCCCTGCTCACCGGGCTCGCCAGCGGCTCCCTCGACCCGGAGGACGACGAG
GTGCGGCACGCCTGCGCGCTGGAAGCCGCCCGGCTGAGGCGGCTGTTCGCGGAGAGCGAC
TGTACGTTCGATCCGCTGGTCCACGAGATGCGCGCCTGTATCGACGTCGCCGAGCGCAAC
GGGACCACCGTGCAACTCGCCGTCCGCGGCGACCCCCTCGAACTGCCCCTGCCCCTGCGC
CGCGCGCTCCTGGACCCGGTCATCGCCGCGCTGGCCGCCGCCGGGCAGACGGCGCGCGTC
ACCGTGGTCCGCGGCGGGGATCAGGTGCGGGTGGGCGTCGTGGTGGACGCGCTGCGGGAC
CGGCTGCCCGAGCCGAAGGCGAACGGGATCCGGGTACGCACGGTCCACGCCGAGGACCGT
CTCCTCGTGGAGGCCGCCTGCCGGATCACAGCTCGTCCAGAGCTATCAGACCGTCCTGAA
CCGCCCTGGCCACCAGCTTGGCCTTCGTGGTCGCCGGCCGGCCGGCGTTCGCGTACTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-33]  0.451 Signal
Eukaryota   
TMHMM
 [20-42]  Transmembrane (i-o) [47-69]  Transmembrane (o-i) [76-98]  Transmembrane (i-o) [126-148]  Transmembrane (o-i) [155-177]  Transmembrane (i-o)
Transmembrane 5