close all open/close all

CDS information : Nanch_00050


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction6,106 / 4,916 / - [in whole cluster]
6,106 / 4,916 / - [in contig]
Locationcomplement(4916..6106) [in whole cluster]
complement(4916..6106) [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative two-component system histidine kinase
Product (GenBank)NanT5
Gene
Gene (GenBank)nanT5
EC number
Keyword
Note
Note (GenBank)
  • putative two-component sensor histidine kinase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q9RIM1
PmId
[16272382] Identification of a novel two-component system SenS/SenR modulating the production of the catalase-peroxidase CpeB and the haem-binding protein HbpS in Streptomyces reticuli. (Microbiology. , 2005)
Family/Domain
FD
IPR003594

close this sectionSequence

selected fasta
>putative two-component system histidine kinase [NanT5]
MSISSLSPGIDPPASARLPGSAGPWAREYVAFNRRLALYGRAGVMSACAVLGVAAMPMGE
MAPAAVVAAAVLAWSWIHLRLATTSAMRQRPLLALDLTVMTALCLSQRFTIPEAQTTHAG
TWILVSVSFTAVAYQLMQPPLTGILATLWLCCADVVGTALHPNLEWSGVLRSVIWVVVNT
ALARAVVRLVFSESRAADEAADRAARARQQGEAAEARCAAEREHLAALHDTACATLLIAS
APWASMRAETLRAQAARDLLRLRAEQPVAGEVDLAAELLDEIAAHPLRVINRFDVELGTT
WRPIAAALRGGLGEALRNVARYAGVDAVRVTAERVDHVIVVTIADSGVGFDPEHIPGHRI
GIKRSIHGRMWNVGGRATVESRPGHGTTVRLEWPRG
selected fasta
>putative two-component system histidine kinase [NanT5]
ATGTCGATTAGCTCACTGTCGCCCGGTATCGATCCGCCGGCCTCGGCGCGCCTTCCCGGC
TCGGCCGGCCCCTGGGCGCGCGAATACGTCGCGTTCAACAGGCGGTTGGCGCTCTACGGC
CGCGCCGGGGTGATGAGCGCCTGCGCCGTGCTGGGCGTGGCGGCCATGCCGATGGGCGAG
ATGGCGCCCGCGGCGGTGGTCGCGGCGGCCGTACTCGCCTGGAGCTGGATCCATCTGCGG
CTCGCCACCACCTCGGCGATGCGGCAGAGGCCGCTGCTCGCCCTGGATCTGACGGTCATG
ACGGCGCTGTGTCTGAGCCAGCGGTTCACGATCCCCGAGGCGCAGACCACGCATGCCGGC
ACCTGGATCCTGGTGTCCGTCAGCTTCACGGCCGTGGCGTACCAGCTGATGCAGCCGCCG
CTCACCGGGATTCTGGCCACGTTATGGCTGTGCTGCGCGGATGTGGTGGGCACCGCGTTG
CACCCGAACCTCGAGTGGTCAGGTGTGCTGCGCAGTGTCATCTGGGTGGTGGTGAACACC
GCCCTGGCCCGGGCCGTGGTCCGGCTGGTGTTCAGCGAGAGCCGGGCGGCCGACGAGGCC
GCCGACCGGGCCGCGCGGGCGCGGCAGCAGGGGGAGGCGGCGGAGGCCCGCTGCGCCGCG
GAACGGGAACACCTGGCCGCGCTCCACGACACCGCCTGCGCGACCCTGCTGATCGCGTCG
GCACCATGGGCGTCGATGCGGGCGGAGACGCTGCGCGCCCAGGCCGCCAGAGATCTCCTC
CGGCTGCGCGCCGAGCAGCCGGTGGCGGGGGAGGTGGACCTGGCCGCCGAACTGCTGGAC
GAGATCGCCGCGCATCCCCTCCGCGTCATCAACAGGTTCGACGTGGAACTGGGCACGACC
TGGCGCCCCATCGCGGCAGCCCTGCGCGGCGGCCTCGGCGAGGCGCTGCGCAACGTGGCC
CGGTACGCTGGCGTCGATGCCGTACGGGTCACGGCGGAGCGCGTGGACCATGTCATCGTC
GTGACCATCGCCGACAGCGGGGTGGGGTTCGACCCGGAGCACATTCCAGGCCACCGGATC
GGGATCAAGCGTTCGATCCACGGCCGGATGTGGAACGTGGGCGGCCGCGCCACCGTCGAG
TCCCGGCCCGGCCACGGTACGACGGTGCGGCTGGAGTGGCCGCGTGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003594 ATPase-like, ATP-binding domain (Domain)
 [312-395]  1.3e-08 G3DSA:3.30.565.10
G3DSA:3.30.565.10   ATP_bd_ATPase
 [303-396]  0.00300000067992871 SM00387
SM00387   HATPase_c
 [312-395]  2.4e-07 PF02518
PF02518   HATPase_c
 [268-395]  2.59999946718995e-15 SSF55874
SSF55874   ATP_bd_ATPase
SignalP
 [1-16]  0.263 Signal
Bacteria, Gram-negative   
 [1-16]  0.117 Signal
Eukaryota   
TMHMM No significant hit