close all open/close all

CDS information : Nanch_00060


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction7,493 / 6,768 / - [in whole cluster]
7,493 / 6,768 / - [in contig]
Locationcomplement(6768..7493) [in whole cluster]
complement(6768..7493) [in contig]
TypeCDS
Length726 bp (241 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)NanR1
Gene
Gene (GenBank)nanR1
EC number
Keyword
  • SARP family
Note
Note (GenBank)
  • putative regulatory protein
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q846W3
NITE
Monen_00280
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative transcriptional regulator [NanR1]
MGPLRVVDEKGGSPLRAQKLAAVLAVLLIRSDQVVMAEQLTREIWGELPPRRDTASIYVC
ISRLRKFLSRPGQQNPIITRPGGYMLRRASSECDFDVFQQLVADGRKCVRYGEPAQAALC
FEQALALWRGPAFGNVQTGPIVAGFLKRLDEMRIECAEMSAEAHLELGRHRELVGRLRSL
VAEFPLRETFYRQLMLALYRSDQKSEALGIYESARRVLDRELGLEPGRKLRELRHTVLAS
T
selected fasta
>putative transcriptional regulator [NanR1]
TTGGGACCTCTCCGTGTAGTCGACGAAAAGGGCGGTTCACCGCTCAGAGCGCAGAAACTC
GCTGCCGTTCTCGCCGTCCTGCTGATCCGCTCGGATCAGGTTGTGATGGCGGAACAGCTC
ACCAGAGAGATCTGGGGCGAGCTGCCGCCGCGCCGCGACACCGCGAGCATCTACGTCTGC
ATTTCGCGGCTTCGCAAGTTCCTGAGCCGGCCGGGCCAGCAGAATCCCATCATCACCCGC
CCCGGTGGATACATGCTGCGCAGAGCGTCCAGCGAATGCGATTTCGATGTCTTCCAGCAG
CTGGTCGCGGACGGCCGGAAGTGCGTCAGATACGGGGAGCCGGCGCAGGCGGCCCTCTGT
TTCGAGCAGGCCCTGGCGCTGTGGCGGGGCCCGGCGTTCGGCAACGTCCAGACCGGGCCG
ATCGTGGCCGGCTTTCTGAAGCGGCTGGACGAGATGCGCATCGAATGTGCGGAAATGTCG
GCCGAGGCGCATCTTGAACTCGGCCGCCACCGGGAACTCGTCGGCCGACTACGTTCCCTG
GTCGCCGAGTTCCCGCTCCGGGAGACGTTCTATCGGCAGCTGATGCTGGCCCTCTACCGC
TCCGACCAGAAGTCAGAGGCGCTTGGCATATACGAGTCCGCCCGGCGTGTTCTCGACAGG
GAACTGGGGCTCGAACCCGGCCGGAAGCTCAGGGAGCTCCGGCACACGGTGCTCGCCTCG
ACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [12-86]  5.20000089003336e-14 SM00862
SM00862   Trans_reg_C
 [18-86]  6.60000000000002e-13 PF00486
PF00486   Trans_reg_C
IPR005158 Bacterial transcriptional activator domain (Domain)
 [93-238]  6.39998633403535e-52 SM01043
SM01043   BTAD
 [93-238]  8.60000000000004e-51 PF03704
PF03704   BTAD
IPR011990 Tetratricopeptide-like helical (Domain)
 [99-216]  8.3e-07 G3DSA:1.25.40.10
G3DSA:1.25.40.10   TPR-like_helical
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [21-87]  4.6e-10 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [1-87]  2.00000075217456e-12 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP
 [1-37]  0.967 Signal
Eukaryota   
 [1-37]  0.336 Signal
Bacteria, Gram-positive   
TMHMM No significant hit