close all open/close all

CDS information : Nanch_00080


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction8,919 / 17,627 / + [in whole cluster]
8,919 / 17,627 / + [in contig]
Location8919..17627 [in whole cluster]
8919..17627 [in contig]
TypeCDS
Length8,709 bp (2,902 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NanA1
Gene
Gene (GenBank)nanA1
EC number
Keyword
Note
Note (GenBank)
  • PKS
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)

close this sectionPKS/NRPS Module

0 malonyl-CoA
1 methylmalonyl-CoA
KSQ22..396
AT559..885
ACP955..1025
KS1047..1423
AT1586..1907
dh1966..2138
kr2491..2660
ACP2766..2836

close this sectionSequence

selected fasta
>polyketide synthase [NanA1]
MRFRYGGVMAGSSPSHAQQATSPVAIVGLACRLPGAPDPEAFWRLLRAGENAVVPVPDSR
LPTEPGSPPYFAGLLEHVDTFDAGFFGISPREATAMDPQQRLMLELAWEAMEDAGLGPKN
LAERRTAVFTGAIWDDYATLLHRRRPNDIAITRHTMAGLHRGLIANRVSHLLGLRGPSLT
VDAAQSSGLVAVHLACESLRRGEADLALAGGVNLILAEESMRMAEAQFQGLSPDGRCYTF
DARANGFVRGEGGGMVLLKPLAAAVADGDPVYCVIEGSAVNNDGATDGLTRPSADAQTDV
VRQAWQRAAVSPAELQYVELHGTGTPVGDPIEAAALGDALGDAFDGCHRDRAVDAPLRVG
SVKTNVGHLEAAAGIAGLLKTALSIHHRRLPPSLNFATPNPGIPLAELGLRVQTAFGPWP
DERRRLTAGVSSFGMGGTNCHVVLAEPPAPAVLPDRPTAPGDVSARTAPPVMPWVVSAAS
PKALTAQAAALYEHLRAHPGLHPVDIGHALATTRTAFPHRAVVLGRDEDELVSRLDALAS
ETQTSGVIRGRAGGGRVAFLFSGQGSQRPGMGRELYAAYPVFADALREVCAHLDPMLDTD
TPLLDLMFAEAPPDGEPPLNRTAYTQPALFAIEVALYRLVTSWGVTPDHLMGHSVGEITA
AHVAGVLSLPDACTLVAARGRLMQSITAPGAMAAWQATAEEAGQALEAYGGRVGLAAVNA
PASVVISGDREAVAEATAAWRARGRKATVLKVSHAFHSPHLDGILGDLRTVAAGLTFAAP
AIPVVSNLTGGAATEAQLRSPDYWADHARQAVRFDAGVRHLCDAGVDTFLELGPDASLTG
MARESAAAWAGDAPRPVAVAVQRRGRPEAQSFVSAMAQAHVRGVGVDWAAAFAGHETRRA
PLPTYAFQRDRHWPDGLDERGARRPSTSPVVPSTDREPVVVDASPADRAASPGELLALVR
THAALVLGHNSPDGIDPALTFKQLGFDSLAATELSERLSAATDTELPATLTFDHPTPNAV
AAWLRAAHEGQPTAAPTAATGPSMAEDPVAVVAVSCRYPGGVESGEALWRLVDEGVDAVG
EFPGDRGWDLAELFGRAPDGSGGSATGRGGFLYGAGDFDAEFFGISPREALAMDPQQRIL
LELSWELLERAGIPPASLAGSATGVYVGATAVDYGPRLHEATAELDGHLLTGSTPSVASG
RVAYALGLEGPALTVDTACSSSLVAMHLAAQALRQGECDLALAGGVTVMATPGMFTSFSR
QRGLAPDGRCKPFAAAADGTGWSEGAGLVLLERLSDARRNGHQVLAVIRGSAVNQDGASN
GLSAPNGPSQQRVIRQALANARLEPADVDAVEAHGTGTTLGDPIEAQALLATYGGQRTDD
RPLWLGSIKSNIGHTQAAAGVAGVIKMVMALRHGRLPASLHIDAPSPHIDWSDGTVRLLS
EPVDWPGTDWPGSDRPRRAAVSSFGISGTNAHLILEQAPDHPEPEPTTSGGVVPWVLSAR
TADALRAQAGRLAEWVTAGAPRSPASPTSPASPADVGWSLATTRSADRHRAVVSGTDRDE
LLSGLRAVADGLAPAAVSAGAAPGPVMVFPGQGSQWRGMGVELLDSSPVFAARMAACEAA
LGEFVDWSLTAVLRGAPGAPEPSRVDVLQPCLWAVMVSLAAVWESYGVTPTAVVGHSQGE
IAAACVAGGLSLRDGARVVALRSQALRALAGHGTMASLALSGAEAERFLADLGAAAARVT
VAVFNGPYSTVVSGPTDQVAAVVAACEAAGHRARTIDVDYASHGPQVDRLADTIRTDLAD
LSPGASDAVFYSAVTGARQPTEELDADYWFTNLRQPVRFASAIDALLAAGYRVFIEVSPH
PVLIPALRECFEEAEVAAATVPTLRRDQGGPDQVARALGDGFVAGLAVDWSRWFVGDGRE
AGDEGHRPRTVELPTYPFQRRRYWLAPDHGRREGRTAGVGTRPAGHALLSSAVELADGGL
VLSGRLPGDAAWVGAHTVAGVQLVPGAVLVDWALLAADEAGGASLEELLLRAPLELSGPS
GLSEPSAGVLAQVAVGAPDESGRRELRISSRPADAGAGEGWTCHAVGSLAPGGPPAPADT
GTATVPWPPAGAEALDPAGLYERAERRGYGYGPALRGVVALWRDGADLVADVALPEEAGG
GGEGGADGDGTAGFGLHPVLLDAALQPALLAEPDGTGGEGAGPEARLWLPFAWSGVRLWA
TGARAARVRLSPLDGGGGDVADERELRIEVSDPTGAPVLSVASVVLRPRTVRQVREASGA
AAGGLFALDWTPVAPQEPSGAEDDAGCVAVLGEAPTEPGVDGCRDTYTDLPALLAALDAG
APLPSVVMWRPPAADPGAAPEDAALSAVRGVAAALRAWVAEPRLTVSRLAVVTRGAVAAG
GAEGEPVDLAAAAAWGCARGVQAEHPDRIVLVDVDDDVDMGADTDTDIGAAAGLAAALGE
PQVALRGDTLLAPRLARSAATPGGVAFDPNGTVLVTDSGGPLAGSVAEHLVRAEGVRHLL
LVRFEGADGAYDTYDRQDAQVHMVTVDPRDTAALERVVAQVDPAHPLTGVVHVAGLSADI
ETSGAARGWAVAAGVVRALHQATAALPSVRFVTLSDAATAWDGPAAPERAAAGAFCAAVT
DVRRRAGLHGLDVAFGPWAAADDDGGADSGGRWTGVLGADRGLALLRAACRADRPRLVAA
DIRTRALTAHPAHELPAALRTLGASASASAGGRAPVRRVAAAAPGRTTDWASRLVGLGPA
ERRRAVLELVRDHAAAVLGQPDPKAVRADASFKELGFDSVTAVELRDRLVAVGGLRLPAA
VVFRHPTPEALAHRIEQQLAPDDTNNAAITDNADNAAKSNGNSNGTALDAADKLASATAD
EILDFIDNELGVLSEARPRPSN
selected fasta
>polyketide synthase [NanA1]
TTGCGATTCAGGTATGGGGGTGTCATGGCCGGGAGCAGCCCGAGCCACGCGCAGCAGGCG
ACGTCTCCCGTCGCGATCGTGGGGCTGGCCTGCCGGCTGCCCGGCGCACCCGATCCCGAG
GCGTTCTGGCGCCTGCTGCGCGCGGGCGAGAACGCCGTCGTGCCCGTCCCGGACAGCCGC
CTGCCGACCGAGCCCGGTTCCCCGCCGTACTTCGCCGGACTTCTGGAGCACGTTGACACG
TTCGACGCCGGATTCTTCGGCATCTCGCCACGCGAGGCCACGGCGATGGACCCGCAGCAA
CGGCTGATGCTCGAACTGGCGTGGGAGGCCATGGAGGACGCGGGGCTCGGCCCCAAGAAC
CTGGCGGAGCGCCGGACCGCGGTGTTCACCGGCGCGATCTGGGACGACTACGCCACGCTC
CTCCACCGGCGCCGCCCCAACGACATCGCCATCACGCGGCACACGATGGCGGGGCTGCAC
CGCGGCCTCATCGCCAATCGGGTCTCCCACCTGCTGGGCCTGCGCGGACCGAGCCTCACG
GTGGACGCGGCCCAGTCCTCCGGGCTCGTCGCCGTGCACCTGGCCTGCGAGAGCCTGCGC
CGGGGCGAGGCCGACCTGGCGCTCGCGGGCGGGGTGAACCTGATCCTGGCCGAGGAGAGC
ATGCGTATGGCCGAGGCCCAGTTCCAGGGCCTCTCGCCGGACGGCCGGTGCTACACCTTC
GACGCGCGCGCCAACGGCTTCGTGCGCGGCGAGGGCGGCGGAATGGTGCTGCTCAAACCG
CTGGCCGCGGCCGTCGCCGACGGCGACCCGGTGTACTGCGTGATCGAGGGCAGCGCGGTC
AACAACGACGGCGCCACCGACGGCCTGACCCGGCCGAGCGCCGACGCCCAGACGGATGTG
GTGCGGCAGGCGTGGCAGCGGGCCGCGGTGTCGCCCGCCGAACTCCAGTACGTCGAACTG
CACGGCACCGGTACGCCGGTCGGCGATCCGATCGAAGCCGCCGCGCTCGGTGACGCGCTC
GGTGACGCATTCGATGGGTGCCATCGGGACCGTGCGGTGGACGCGCCGCTGCGGGTCGGC
TCGGTCAAGACCAACGTGGGCCATCTGGAGGCCGCCGCCGGTATCGCGGGCCTGCTGAAG
ACGGCCCTGAGCATCCACCACCGGCGACTTCCGCCGAGTCTCAACTTCGCCACCCCGAAC
CCCGGCATCCCGCTGGCCGAACTCGGCCTGCGCGTACAGACCGCGTTCGGGCCCTGGCCC
GACGAGCGGCGGCGGCTCACGGCCGGGGTCAGCTCCTTCGGCATGGGCGGTACCAACTGC
CATGTCGTCCTGGCCGAACCGCCCGCCCCGGCCGTGCTGCCGGACCGGCCCACGGCGCCC
GGGGACGTGTCCGCGCGCACCGCCCCGCCGGTCATGCCCTGGGTCGTATCGGCGGCGAGT
CCGAAGGCCCTCACGGCCCAGGCCGCCGCGCTGTACGAACACCTGCGCGCACACCCCGGG
CTCCACCCGGTGGATATCGGCCACGCGCTTGCCACGACCCGTACGGCGTTCCCGCACCGA
GCCGTCGTCCTCGGCAGGGACGAAGACGAACTGGTAAGCCGACTCGACGCGTTGGCCTCC
GAAACACAGACATCGGGAGTGATCCGTGGCCGCGCGGGCGGGGGCCGGGTCGCGTTCCTG
TTCAGCGGCCAGGGCAGCCAGCGCCCCGGCATGGGCCGCGAACTGTACGCGGCGTACCCG
GTCTTCGCCGACGCGCTGCGCGAGGTGTGCGCGCACCTGGACCCCATGCTCGACACCGAC
ACCCCGCTGCTGGACCTCATGTTCGCCGAGGCCCCACCGGACGGCGAGCCGCCGCTGAAC
CGGACCGCGTACACCCAGCCCGCGCTCTTCGCCATCGAGGTGGCCCTCTACCGCCTGGTG
ACCTCGTGGGGCGTGACCCCCGACCACCTGATGGGCCACTCGGTCGGCGAGATCACGGCC
GCGCATGTGGCCGGGGTGCTGTCGCTGCCCGACGCCTGCACGCTGGTGGCGGCCCGGGGC
CGCCTCATGCAGTCCATCACCGCCCCCGGGGCGATGGCCGCCTGGCAGGCCACCGCCGAG
GAGGCCGGGCAGGCGCTGGAGGCGTACGGCGGACGGGTGGGCCTCGCGGCCGTCAACGCA
CCCGCCTCCGTGGTGATCTCCGGCGACCGCGAGGCCGTGGCGGAGGCGACCGCCGCCTGG
CGGGCGCGGGGCCGCAAGGCCACCGTGCTCAAGGTCAGCCACGCCTTCCACTCCCCGCAC
CTCGACGGCATCCTCGGGGACCTGCGCACGGTCGCGGCCGGGCTGACATTCGCCGCGCCC
GCCATCCCCGTCGTATCCAATCTGACCGGCGGGGCGGCCACCGAGGCCCAGTTGCGCTCG
CCCGACTACTGGGCCGACCACGCCCGGCAGGCCGTACGGTTCGACGCCGGGGTACGGCAC
CTGTGCGACGCGGGGGTCGACACCTTCCTCGAACTCGGCCCCGACGCCTCGTTGACCGGC
ATGGCGCGGGAGAGCGCCGCGGCATGGGCCGGCGACGCGCCCCGCCCGGTGGCGGTCGCG
GTGCAGCGCCGCGGCCGACCGGAGGCGCAGAGCTTCGTGTCGGCGATGGCCCAGGCGCAC
GTACGGGGCGTCGGCGTCGACTGGGCGGCCGCGTTCGCGGGCCACGAGACCCGGCGGGCG
CCCCTGCCGACGTACGCCTTCCAGCGCGATCGCCACTGGCCCGACGGGCTGGACGAGCGG
GGGGCGAGGCGGCCGAGTACCTCGCCGGTCGTGCCGTCAACCGACCGTGAGCCGGTCGTC
GTTGACGCGTCCCCCGCCGATCGCGCGGCCTCCCCGGGCGAGCTGCTGGCGCTGGTACGT
ACCCACGCCGCCCTCGTACTCGGACACAACAGCCCCGACGGCATCGACCCGGCCCTGACC
TTCAAACAGCTCGGCTTCGACTCGCTGGCCGCCACGGAGCTGAGCGAACGCCTGAGCGCG
GCCACGGACACCGAACTCCCCGCCACCCTCACCTTCGACCACCCGACGCCGAACGCCGTG
GCGGCGTGGCTGCGCGCGGCGCACGAGGGGCAGCCCACCGCCGCCCCGACGGCGGCGACA
GGGCCGTCCATGGCCGAGGACCCCGTCGCCGTGGTGGCCGTCAGCTGCCGCTACCCCGGC
GGGGTCGAGTCGGGCGAGGCGCTGTGGCGCCTGGTGGACGAAGGGGTCGACGCCGTGGGC
GAGTTCCCCGGCGACCGGGGCTGGGATCTGGCGGAGCTGTTCGGCCGGGCGCCGGACGGG
AGCGGCGGCAGCGCGACGGGCCGGGGCGGCTTTCTGTACGGCGCCGGGGACTTCGACGCG
GAGTTCTTCGGGATCAGCCCGCGCGAGGCGCTGGCCATGGATCCGCAGCAGCGCATCCTG
CTCGAACTCTCCTGGGAACTGCTGGAACGGGCCGGGATCCCCCCGGCCTCGCTGGCCGGC
AGCGCGACCGGCGTCTACGTCGGGGCGACGGCGGTGGACTACGGGCCGCGGCTGCACGAG
GCCACCGCCGAGCTCGACGGACACCTGCTGACCGGCTCCACGCCGAGCGTGGCGTCCGGC
CGGGTGGCCTACGCCCTCGGCCTGGAGGGTCCGGCGCTCACGGTGGACACGGCGTGTTCG
TCGTCGCTGGTGGCGATGCACCTGGCCGCGCAGGCGCTGCGGCAGGGCGAATGCGATCTG
GCGCTGGCGGGCGGTGTGACGGTGATGGCCACACCGGGCATGTTCACCTCCTTCTCCCGG
CAGCGCGGGCTGGCGCCTGACGGGCGGTGCAAGCCGTTCGCCGCCGCCGCCGACGGCACG
GGGTGGAGCGAGGGCGCCGGGCTCGTCCTGCTCGAACGCCTCTCCGACGCCCGCCGCAAC
GGCCACCAGGTGCTCGCCGTGATCCGCGGCTCGGCGGTCAACCAGGACGGCGCGAGCAAC
GGCCTGTCCGCCCCCAACGGCCCCTCCCAGCAACGCGTCATCCGCCAGGCCCTGGCCAAC
GCCCGCCTCGAACCCGCGGACGTGGACGCGGTCGAGGCCCATGGCACGGGCACGACGCTG
GGCGACCCCATCGAGGCCCAGGCCCTCCTGGCCACGTACGGCGGGCAACGCACCGACGAC
CGGCCGCTGTGGCTGGGCTCCATCAAGTCGAACATCGGCCACACCCAGGCCGCCGCCGGC
GTCGCGGGCGTCATCAAGATGGTGATGGCCCTGCGCCACGGCCGCCTCCCGGCCAGCCTC
CACATCGACGCCCCCAGCCCGCATATCGACTGGTCCGACGGTACGGTCAGGCTCCTCAGC
GAGCCCGTCGACTGGCCCGGGACCGACTGGCCCGGATCCGACCGGCCCCGCCGCGCCGCC
GTCTCCTCCTTCGGCATCTCCGGCACCAACGCCCACCTCATCCTCGAACAGGCACCCGAC
CACCCCGAACCGGAGCCCACCACCTCGGGCGGCGTGGTGCCCTGGGTGCTGTCGGCCCGT
ACCGCCGACGCGCTCCGCGCCCAGGCCGGCCGCCTGGCCGAGTGGGTCACCGCTGGCGCC
CCGCGCTCCCCGGCCTCCCCGACCTCCCCGGCCTCCCCGGCGGACGTGGGGTGGTCGCTG
GCCACCACGCGGTCGGCGGACCGCCACCGAGCCGTGGTTAGCGGTACGGACCGGGACGAG
CTGCTGTCCGGGCTGCGCGCGGTGGCGGACGGCCTCGCGCCCGCCGCCGTCTCGGCGGGG
GCGGCCCCCGGCCCGGTCATGGTGTTCCCCGGACAGGGGTCGCAGTGGCGTGGCATGGGC
GTGGAACTGCTGGACTCCTCCCCCGTCTTCGCGGCCCGCATGGCCGCGTGCGAGGCGGCG
CTCGGCGAGTTCGTCGACTGGTCCCTCACCGCCGTGCTGCGCGGCGCGCCGGGCGCGCCC
GAGCCGTCCCGGGTCGATGTCCTCCAGCCGTGCCTGTGGGCGGTGATGGTGTCGCTCGCC
GCCGTCTGGGAGAGCTACGGCGTGACGCCCACCGCGGTCGTCGGACACTCGCAGGGCGAG
ATCGCCGCCGCGTGCGTCGCCGGGGGCCTGTCGCTCCGGGACGGCGCCAGGGTCGTGGCG
CTGCGCTCCCAAGCCCTGCGCGCCCTCGCCGGCCACGGCACCATGGCCTCGCTCGCGCTG
AGCGGCGCGGAGGCCGAGCGCTTCCTCGCGGACCTGGGTGCGGCGGCGGCACGGGTGACG
GTGGCGGTGTTCAACGGGCCGTACTCCACGGTGGTGTCGGGGCCCACCGACCAGGTCGCC
GCGGTGGTGGCGGCCTGTGAGGCGGCGGGCCACCGGGCCCGCACGATCGACGTGGACTAC
GCCTCGCACGGCCCGCAGGTCGACCGGCTCGCGGACACGATCCGCACCGACTTGGCCGAC
CTCTCCCCCGGCGCCTCGGACGCGGTGTTCTACTCCGCCGTCACCGGCGCCCGGCAGCCG
ACGGAGGAGCTGGACGCCGACTACTGGTTCACCAATCTGCGGCAGCCGGTGCGGTTCGCG
TCGGCGATCGACGCCCTGCTGGCCGCCGGGTACCGCGTGTTCATCGAGGTCAGCCCTCAT
CCGGTGCTGATCCCCGCGCTACGGGAGTGCTTCGAGGAGGCCGAGGTGGCGGCGGCCACC
GTGCCGACGCTGCGCCGGGACCAAGGCGGCCCGGATCAGGTGGCGCGCGCCCTGGGGGAC
GGCTTCGTGGCGGGGCTCGCGGTCGACTGGAGCCGCTGGTTCGTCGGCGACGGGCGTGAG
GCGGGCGACGAGGGCCACCGGCCGCGTACGGTCGAGCTGCCCACGTATCCGTTCCAGCGG
CGGCGGTACTGGCTGGCGCCGGACCACGGCCGCCGCGAGGGCCGCACGGCCGGGGTCGGA
ACCCGGCCGGCCGGGCACGCCCTGCTGTCCTCGGCGGTCGAACTGGCCGACGGCGGCCTG
GTGCTGAGCGGCCGGCTTCCCGGCGACGCGGCCTGGGTGGGCGCGCACACCGTGGCGGGC
GTCCAGTTGGTGCCCGGCGCGGTCCTGGTGGACTGGGCGCTGCTCGCCGCCGACGAGGCG
GGCGGGGCGTCGCTGGAGGAACTGCTGCTGCGCGCGCCCCTGGAGCTGTCCGGGCCGTCC
GGGCTGTCCGAGCCGTCCGCGGGTGTGCTGGCGCAGGTCGCGGTCGGGGCGCCTGACGAG
TCGGGCCGCCGTGAGCTACGGATCTCCTCCCGGCCCGCCGACGCGGGCGCGGGCGAGGGC
TGGACGTGTCACGCGGTGGGGTCGCTGGCCCCGGGCGGCCCGCCCGCTCCGGCGGACACC
GGGACCGCGACCGTCCCCTGGCCGCCCGCGGGCGCCGAGGCGCTGGATCCGGCCGGGCTG
TACGAGCGGGCCGAGCGGCGCGGCTACGGCTACGGGCCCGCGCTGCGGGGCGTTGTGGCG
CTGTGGCGGGACGGCGCCGACCTGGTGGCGGACGTGGCGCTGCCCGAGGAGGCCGGTGGC
GGCGGCGAAGGCGGTGCGGACGGCGACGGTACGGCCGGATTCGGCCTGCACCCCGTCCTG
CTGGATGCCGCGTTGCAGCCCGCGCTGCTGGCCGAACCGGACGGCACCGGTGGCGAGGGA
GCGGGGCCGGAAGCCCGGTTGTGGCTGCCGTTCGCGTGGAGCGGCGTCCGGCTGTGGGCG
ACCGGGGCGCGCGCCGCGCGGGTCCGGCTGTCGCCGCTGGACGGGGGCGGTGGGGATGTT
GCGGACGAGCGCGAGCTGCGGATCGAGGTGTCCGACCCGACCGGGGCTCCCGTGCTGAGC
GTCGCGTCGGTGGTGCTGCGCCCGCGCACCGTACGGCAGGTGCGCGAGGCGAGCGGGGCC
GCGGCGGGTGGTCTCTTCGCCCTCGACTGGACGCCGGTGGCGCCTCAGGAGCCGTCCGGC
GCCGAGGACGACGCCGGGTGTGTGGCCGTACTGGGCGAGGCGCCGACGGAGCCGGGCGTG
GACGGGTGCCGGGACACCTATACGGATCTCCCGGCGCTGCTGGCCGCCCTGGACGCGGGT
GCGCCCTTGCCCTCCGTGGTGATGTGGCGGCCACCGGCCGCCGACCCCGGCGCCGCACCC
GAGGACGCCGCCCTGTCCGCCGTACGAGGCGTGGCGGCGGCGCTGCGCGCCTGGGTCGCC
GAGCCGCGGCTGACGGTCAGCCGGCTCGCGGTGGTCACTCGGGGCGCGGTCGCGGCGGGC
GGCGCCGAGGGCGAGCCGGTGGACCTGGCCGCGGCGGCGGCCTGGGGCTGTGCCCGTGGT
GTCCAGGCGGAACACCCCGACCGCATCGTCCTCGTCGACGTGGACGACGACGTCGACATG
GGCGCGGACACCGACACCGACATCGGCGCGGCGGCGGGTCTGGCGGCCGCGCTCGGCGAA
CCACAGGTCGCGTTGCGCGGGGACACGCTGCTCGCGCCACGCCTGGCGCGTTCCGCGGCC
ACCCCGGGCGGCGTGGCATTCGACCCGAACGGCACGGTCCTCGTCACGGACTCCGGAGGC
CCGCTCGCCGGTTCGGTCGCCGAGCATCTGGTGCGCGCCGAGGGTGTCCGGCACCTGCTG
CTGGTCCGCTTCGAGGGCGCGGACGGCGCCTACGACACGTATGACAGGCAAGACGCCCAG
GTGCACATGGTCACGGTTGATCCTCGCGACACCGCCGCGCTGGAACGGGTGGTGGCGCAG
GTCGATCCGGCCCATCCGCTGACCGGCGTCGTCCATGTCGCGGGACTGTCCGCCGACATC
GAGACAAGTGGCGCGGCGCGCGGGTGGGCCGTGGCGGCCGGGGTGGTGCGGGCCCTGCAC
CAGGCCACCGCCGCGCTGCCGTCCGTCCGGTTTGTGACCCTGTCCGACGCCGCGACGGCC
TGGGACGGCCCGGCGGCCCCCGAAAGGGCGGCGGCCGGTGCGTTCTGCGCGGCCGTGACG
GACGTACGGCGCCGGGCCGGACTGCACGGCCTGGACGTCGCGTTCGGGCCCTGGGCCGCC
GCCGACGACGATGGCGGCGCCGATTCCGGTGGGCGCTGGACCGGGGTCCTCGGCGCCGAC
CGCGGGCTCGCGCTGCTGCGCGCGGCCTGTCGCGCCGACCGCCCGCGGCTGGTGGCGGCC
GACATCCGTACCCGAGCCCTGACCGCCCATCCGGCCCACGAGCTCCCGGCCGCGCTGCGC
ACGCTCGGCGCGAGTGCGAGTGCGAGTGCGGGCGGCCGGGCGCCGGTCCGTCGGGTCGCC
GCCGCCGCGCCCGGCCGCACCACCGACTGGGCGAGCCGGCTGGTGGGCCTCGGGCCCGCC
GAACGGCGCCGCGCCGTCCTGGAGCTGGTACGCGATCACGCCGCCGCCGTGCTCGGGCAG
CCCGACCCCAAGGCCGTACGGGCCGACGCCTCGTTCAAGGAGCTGGGCTTCGACTCGGTG
ACCGCCGTCGAGCTGCGCGACCGGCTGGTGGCGGTCGGCGGGCTGCGGCTGCCCGCCGCC
GTCGTCTTCCGCCACCCGACGCCGGAGGCGCTGGCCCACCGTATCGAGCAGCAACTCGCG
CCCGACGACACGAATAACGCAGCTATCACAGACAACGCAGACAACGCAGCAAAGAGCAAC
GGCAACAGCAACGGCACGGCGCTCGACGCGGCGGACAAGCTCGCGTCGGCCACGGCCGAC
GAAATCCTCGACTTCATCGACAACGAGCTCGGCGTGCTCTCCGAAGCGCGTCCGCGCCCC
TCCAACTGA
[0] KSQ22..396
[0] AT559..885
[0] malonyl-CoA754..758
[0] ACP955..1025
[1] KS1047..1423
[1] AT1586..1907
[1] methylmalonyl-CoA1780..1784
[1] dh1966..2138
[1] kr2491..2660
[1] ACP2766..2836
[0] KSQ64..1188
[0] AT1675..2655
[0] malonyl-CoA2260..2274
[0] ACP2863..3075
[1] KS3139..4269
[1] AT4756..5721
[1] methylmalonyl-CoA5338..5352
[1] dh5896..6414
[1] kr7471..7980
[1] ACP8296..8508

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [551-686]  G3DSA:3.40.366.10 [754-874]  G3DSA:3.40.366.10 [1581-1709]  G3DSA:3.40.366.10 [1780-1897]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [983-998]  PS00012 [2794-2809]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [954-1029]  1.99999999999999e-40 G3DSA:1.10.1200.10 [2763-2840]  1.99999999999999e-40 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [955-1025]  PS50075 [2766-2836]  PS50075
PS50075   ACP_DOMAIN
 [959-1024]  2.4e-10 PF00550 [2769-2835]  5.10000000000001e-11 PF00550
PF00550   PP-binding
 [948-1063]  1.10000150671642e-24 SSF47336 [2757-2843]  1.20000117458134e-21 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [2491-2660]  1.2e-20 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [22-264]  7.59999999999998e-81 PF00109 [1047-1297]  1.29999999999998e-88 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [272-396]  9e-38 PF02801 [1305-1423]  1e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [559-885]  1.29999999999998e-65 PF00698 [1586-1907]  7.09999999999991e-100 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [556-848]  2.1000026783403e-69 SSF52151 [1584-1889]  4.69998262513195e-63 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [688-753]  7.60000011115812e-17 SSF55048 [1711-1779]  6.80000200614766e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [22-275]  G3DSA:3.40.47.10 [276-448]  1.39999999999997e-124 G3DSA:3.40.47.10 [1046-1308]  G3DSA:3.40.47.10 [1309-1480]  1.39999999999997e-124 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [14-393]  4.10001399699315e-86 SSF53901 [1039-1421]  2.50000909916183e-97 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2492-2624]  7.1e-07 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1210-1226]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [560-866]  1.90000694315261e-122 SM00827 [1588-1888]  2.59998233910302e-110 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [956-1028]  9.00000407957274e-28 SM00823 [2767-2839]  8.70001261213513e-29 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [1966-2138]  5.20000089003336e-54 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [24-449]  SM00825 [1049-1480]  SM00825
SM00825   PKS_KS
SignalP
 [1-17]  0.999 Signal
Bacteria, Gram-negative   
TMHMM No significant hit