close all open/close all

CDS information : Nanch_00100


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction24,310 / 36,408 / + [in whole cluster]
24,310 / 36,408 / + [in contig]
Location24310..36408 [in whole cluster]
24310..36408 [in contig]
TypeCDS
Length12,099 bp (4,032 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NanA3
Gene
Gene (GenBank)nanA3
EC number
Keyword
Note
Note (GenBank)
  • PKS
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)

close this sectionPKS/NRPS Module

3 malonyl-CoA
4 methylmalonyl-CoA
KS42..415
AT576..921
DH969..1153
KR1494..1671
ACP1773..1843
KS1874..2251
AT2406..2727
DH2774..2939
ER3273..3580
KR3590..3770
ACP3873..3943

close this sectionSequence

selected fasta
>polyketide synthase [NanA3]
MSGGAVTTETNEERLVDYLKRVAADLHDTRARLREVEDGQREPVAIVAMACRYPGDVASP
EDLWDLVAARRHAMTAFPDNRGWDLERLFHPDPDHPGTSYAREGGFLHDADLFDPEFFGI
SPREAAAVDPQQRLLLEVAWEALERAGIAPGSLKGAPVGVYAGTALPGFGTPHIDRAAEG
YLVTGNAPSVLSGRVAYTLGLEGPAVTVDTACSSSLVAMHLAAQALRQGECELALAGGVT
VMTTPYVFTEFARQRGLAADSRCKAFSKGADGTAFAEGAGLLVLERLSDAQRNGHQVLAV
MRGSAINQDGASNGLTAPNGLAQQRVIRQALAGARLSPADVDVVEAHGTGTTLGDPIEAQ
ALLATYGQERPEGRPLWLGAIKPNLGHTQGAAGVAGVIKMVMALRNASLPALLHADRPTS
VVDWDGGAVRLLAEPVAWPAGDRRRRAGVSSFGISGTNAHLILEEAPPRPDTELPASVPQ
RPEGTVVPWVVSARGAVSLRTQAAALAEHMAAHPDTPVDAIGWSLATTRSPLDHRAVVLG
ADRGELSARLADLAEGRTHPDVTRASAPARLGGSAFLFTGQGSQRPGMGAQLYRAYPAFA
AAFDEACAALDPHLGRSLLELVFAPADTDGDGDADRASALDATEVTQAALFAVEVALYRL
VESFGVVPGYLAGHSVGELVAAHIAGVLSLPDAARLVAARGRLMQALPEGGAMVALEAAE
EEVALLLAGRADQVALAAVNAPTSVVVSGDEEAVEEIARTIRERGHRTRRLRVGHAFHSP
RIDPMLEEFRQVAASLTYSQPRIAVVSNVTGALAGAEQLCDPDYWVRHARQPVRFRDGIA
ALRAEGVTRFLELGPDAVLTAMARDCLTSEAAPEVAAGESAQDAGTASGPSAPVLATVLR
KGRDEPRTLLTALAQLHVDGESVDFSASFPATTQATDLPTYRFDRRRYWRDAPQAEADVR
AAGLEASDHPLLRAALEPADGGLLLTGRLSLRGQPWLADHAIVDAVPLPGTLFVELALQA
GERVGCDLIDDLTLEAPLLLPPVGAVDLQVAVGATDAAGRRAVTVYSRPSGGGSEGWESS
ADPGVADEPGDGPYGPWRRHATATLGTAPTGVPEPAASPAQWPPAGAEAIDVAGLYERLA
AEGYRYGPAFTGLRTAWRVGEEMFAEVGLAPGQRGDGGAYAVHPALLDAALHPIGALFTG
EDQAGGAPGTVRLPFSFGGVRLLARGASRLRVRITPTGPDTVTMRLSDDTGAEVVAVDSL
TLRTVSAQRWRSGAVPADRPLYRLDWDAFALPAAATTAPDRWAVLAADDTNATDTATASL
PAEHVARHPDLAALSASVAAGAPAPDLVVMACLGAPYDTSDDGDEPPSQVRTATHRVLAR
LREWLTDDALAASRLVVLTAKAVAADPADAPPDLAGAAVLGLLRAAQAEHPGRIVLVDTD
GISASRDALAAAVAAAVAAGEWQLALRDGRALVPRLILAHPDPDAAPVVLDPDGTVLVTG
GTGSLGRLLARHLVEHHGARHLLLVSRSGPAAEGIEAFAAGLAADVRIESCDTTDPEALA
ALLATVPGEHPLTAVVHTAGVLDDGVVTSLTPEQLDTVLAPKVDAAWQLHRLTRGADLAS
FVLFSSAASVLGSGGQGNYGAANAFLNALAEHIRAAGGPATSLAWGLWGVDEGMTEHLAT
ADRARMARSGTAAMSGEAGLARFDAALATALPVLVPARFDLAVLREQAAGGALPPLLRRL
VRLPVRTAAAVEASPSWAGRLAGLPETEQDRVIGELIRDRIAAVLAHPEPETLELGRTFA
QLGLDSLTALELRNAIHEATGVRLPATAIFDYPTPETLVSHLRTELLGATATTAATAPLP
PGAGAPARSGSADDPVVIVGMACHYPGDVHSPDELWRLVADGVDAIGPFPEDRGWDVAGL
YDPDPERTGKSYTREGGFLPEAALFDAEFFGISPREALATDPQQRLLLETAWQAFEHARI
DPAALRGSRTAVVTGIMYDDYGARFLGRIPEGYEGQIMTGSTPSVASGRVAYTFGLEGPT
LTVDTACSSSLVAMHLAAQALRQGECDLALAGGVTVMATPNTFIEFSRQRGLAPDGRCKP
FAAAADGTGWSEGAGLLVLERLSDARRNGHRVLAVLRGSAVNQDGASNGLTAPNGPSQQR
VIGQALAAAGVDPAGVDVVEAHGTGTMLGDPIEAQALLATYGRNRPAEQPLWLGSIKSNI
GHTQAAAGAAGIIKMVMALRHGRLPATLHVDEPSPHVDWASGSVRLLTEATDWPEADRPR
RAAVSSFGISGTNAHLILEQAPDQPEPLPEQSESATAGGIVPFVLSARTAEALRAQAANL
AARLPSAGVAEVGWSLATTRSAFEHRAVIVAEDRDALLAGLEKLAADEPDPAVVAGTATT
AAAGPVFVFPGQGSQWRGMGVELLDTSPVFAARIAECERALAPYVDWSLTAVLRGSDTTT
DPHRVDVVQPTLWAVMVSLAALWQHLGIAPAAVIGHSQGEIAAACVAGALTLDDAAKVVA
LRSQALRALAGHGTMASLTLGADDTAGLLEELGERADDVTVAAANGPVTTVISGAVEQIA
TVLAAAEAHGARTRTIDVDYASHGPHVDRIREDIVSALSGLAPTASEVAFYSTVTAERLD
TAGLDADYWFTNLRRPVRFADTLATLLAHGHRHFIEVSPHPVLIPGMQDGFEAADAAATA
VPTLRRDQGGPHQLAQAVARAYTAGLAIDWAPWYPARPYTTDLPTYPFQRRRYWLGMDGG
PGDLRSAGLVSVSHAQIGAAVELADGGLVMTGRLPAAGSGGWLDDHVVADTPLVPGTALV
EWVLRAADEAGCGGIEELALHVPMTLPASGGLRIQVVAYAPDGDGRREVRVHSRPDAEDG
SSPWTCHATGHLSPTAPGAADPAPAGVWPPRDAEQVDVADFYGRAEAIGYGYGPAFRGLT
AAWRQGDDLLAEVVLPEAAHEGADGFALHPALLDAALHPLALDGQGEDGRMRLPFAWSGV
SLWATGARAARVRMSPLEHGFRLVVADAAGRPVLSAESVVVRPTSARQLRDAGARRVDGL
YEVAWVALPPSSDTVAETETRGVEGWALLDGGPLPFDPSKAGSLPRHADIDALLTAPALP
STVLVGVSGPVGAAGDENSAEGALAVTTGVLTSARRWLETPELADARLVLVTRGAVAAAE
TDDGPDPAAAAVWGLLRSAQAENPGRFLLCDIDDGAGPDDVLGAVTRAVALDEPQVAVRG
ERVLTPRLERAGAAELVPPPGEPAWRLSADDTGTIDSVSVVACPEVLEPLAPGQVRIAVR
AAGINFRDVLIVLGMYPDEGVFRGSEGAGVVLDVADDVTSVAVGDRVFGLFEGAFGPVAV
ADARAVVPVPPDWTDQQAAAVPTTFLTAWYGLVDLAGLKAGESVLIHAATGGVGTAAVQI
ARHLGAEVYATAGPGKHAVLEAMGIDEAHRASSRDLDFEDAFRTATGGRGVDVILNSLAG
EYTDASLRLLTGGGRFIEMGKTDKRDAEQIADTYSGVRYRFYDLVPDAGLDRVAEMLTTL
AGHFAQGVLAPPPVRAWPLTEARQALRQMSQARHTGKYVLDMPRTLDPDGTVLITGGTGT
LGALVAEHLVTNHHISHLHLLSRRGPDAPGSADLAARLTELGATVRITATDTTDPQALRQ
ALDTVDRDHPLTGVIHAAGALDDAVLTAQTPERLASVWAAKATAAANLHRATKDLPLAMF
VIFSSAAGTLGTPGQANYAAANAYCDALAVRRRRAGLPATSIAWGLWAATSEMTGHLADA
DLARMSRTGFTPLATPMALALFDAAGRHGAATPLALDLDPRTLGAQPSDAVPAVLRTVAA
AGAPVRRTAAVAQSTDWAGRLAALSAAERHRELVNLVRTHAATVLGHSDPAALRADTSFK
ELGFDSLTAVELRNRLSAATGLRLPAALVFDYPDAETMARFLDQKLAPGDRTEAAAVDHL
APVLNDLARLESTLGSHDVDGKARETVAGRLHALLSRLEGSTASAADIDGEALESASDDE
MFALIDQQLGSS
selected fasta
>polyketide synthase [NanA3]
ATGAGCGGGGGCGCTGTGACCACTGAGACGAACGAAGAGCGGCTGGTCGATTACCTCAAG
CGGGTCGCCGCGGATCTGCACGACACGCGGGCGCGGCTGCGCGAGGTGGAGGACGGACAG
CGGGAACCGGTGGCCATCGTGGCGATGGCCTGCCGCTACCCCGGCGACGTCGCCTCCCCC
GAGGATCTGTGGGACCTCGTCGCCGCGCGCCGGCACGCGATGACCGCGTTTCCGGACAAC
CGCGGCTGGGACCTGGAGCGGCTGTTCCACCCGGACCCCGACCACCCGGGCACCAGCTAC
GCCCGCGAGGGCGGATTCCTGCACGACGCCGACCTGTTCGACCCGGAGTTCTTCGGCATC
AGCCCCCGCGAGGCGGCGGCGGTCGACCCGCAGCAGCGGCTGCTGCTCGAAGTGGCCTGG
GAGGCGCTGGAGCGGGCGGGCATCGCGCCCGGGTCGCTCAAGGGCGCGCCGGTCGGCGTG
TACGCGGGCACCGCGCTGCCCGGCTTCGGCACCCCGCATATCGACCGGGCCGCGGAGGGC
TATCTGGTCACCGGCAACGCGCCGAGCGTGCTGTCCGGCCGGGTGGCGTACACCCTGGGC
CTGGAGGGGCCCGCGGTCACGGTGGACACGGCGTGTTCGTCGTCGCTGGTGGCGATGCAT
CTGGCCGCGCAGGCGCTGCGGCAGGGCGAATGCGAGCTCGCGCTGGCGGGCGGTGTGACG
GTCATGACGACGCCTTATGTGTTCACGGAGTTCGCCCGGCAGCGCGGCCTGGCGGCGGAC
AGCCGGTGCAAGGCGTTCTCCAAGGGGGCCGACGGCACGGCGTTCGCCGAGGGCGCGGGG
CTGCTGGTGCTGGAGCGGCTGTCGGACGCCCAGCGCAACGGACATCAGGTGCTGGCCGTG
ATGCGCGGTTCGGCGATCAACCAGGACGGTGCGAGCAACGGGCTGACCGCGCCCAACGGT
CTGGCGCAGCAGCGCGTCATCCGGCAGGCGCTGGCCGGCGCCCGGCTCTCCCCGGCGGAT
GTGGATGTGGTCGAGGCGCATGGTACGGGCACCACGCTCGGTGACCCGATCGAGGCCCAG
GCGCTGCTGGCCACCTACGGTCAGGAGCGGCCCGAGGGCCGGCCGCTGTGGCTGGGCGCG
ATCAAGCCGAACCTCGGGCATACGCAGGGCGCGGCGGGCGTGGCCGGCGTGATCAAGATG
GTGATGGCGCTGCGGAACGCCTCGCTGCCCGCCCTGCTGCACGCCGACCGGCCCACGTCC
GTGGTCGACTGGGACGGTGGCGCGGTACGGCTGCTGGCCGAGCCGGTGGCGTGGCCGGCC
GGGGACCGGCGGCGCCGGGCCGGCGTCTCGTCCTTCGGTATCAGCGGGACCAACGCGCAT
CTGATCCTCGAGGAGGCCCCGCCACGGCCGGACACGGAGCTGCCCGCGAGCGTGCCTCAG
CGGCCGGAGGGCACCGTCGTGCCGTGGGTGGTCTCCGCGCGGGGCGCGGTGTCGCTTCGT
ACGCAGGCCGCGGCGCTCGCCGAGCACATGGCCGCGCACCCGGACACCCCGGTCGACGCC
ATCGGCTGGTCGCTGGCCACCACACGGTCGCCGCTCGACCACCGCGCGGTCGTGCTGGGC
GCGGACCGCGGGGAGTTGTCCGCCCGGCTCGCCGACCTCGCCGAGGGGCGGACCCACCCC
GATGTGACGCGGGCGTCCGCCCCGGCGCGGCTCGGTGGCAGCGCGTTTCTCTTCACCGGG
CAGGGCAGCCAGCGCCCCGGCATGGGCGCCCAGCTGTACCGGGCCTATCCGGCGTTCGCC
GCCGCGTTCGACGAGGCGTGTGCGGCGCTCGACCCCCATCTGGGGCGGTCGCTGCTGGAG
TTGGTGTTCGCACCGGCCGACACAGACGGAGACGGAGATGCGGACAGGGCGAGCGCGCTG
GACGCGACGGAGGTGACCCAGGCCGCGCTGTTCGCGGTCGAGGTCGCCCTGTACCGGCTG
GTCGAGTCGTTCGGTGTGGTCCCCGGCTATCTGGCGGGACACTCGGTCGGCGAACTGGTC
GCCGCGCATATCGCCGGGGTGCTGTCGCTGCCGGACGCCGCGCGGCTGGTCGCCGCCCGG
GGGCGGCTGATGCAGGCGCTGCCCGAGGGTGGCGCGATGGTCGCGTTGGAGGCCGCCGAG
GAGGAGGTGGCGCTGCTGCTCGCCGGGCGGGCGGACCAGGTGGCGCTGGCGGCCGTGAAC
GCGCCGACGTCGGTGGTGGTCTCGGGTGACGAGGAGGCGGTCGAGGAGATCGCCCGTACG
ATCCGGGAGCGCGGACACCGGACCAGGCGGCTGCGGGTCGGTCACGCCTTCCACTCGCCG
CGGATCGACCCGATGCTGGAGGAGTTCCGGCAGGTCGCGGCCTCACTGACGTATTCACAG
CCCCGGATCGCCGTCGTCTCGAACGTCACCGGCGCGCTGGCCGGGGCCGAGCAGCTGTGC
GACCCCGACTACTGGGTGCGGCATGCGCGGCAGCCGGTGCGGTTCCGCGACGGTATCGCC
GCGCTGCGCGCGGAGGGTGTCACCCGCTTCCTGGAGCTCGGCCCGGACGCCGTGCTCACC
GCCATGGCGCGCGACTGCCTGACCTCGGAGGCGGCCCCGGAGGTGGCCGCCGGGGAATCG
GCCCAGGATGCCGGCACGGCCTCCGGTCCCAGCGCGCCGGTGCTCGCCACGGTGTTGCGC
AAGGGCCGCGACGAGCCCCGTACGCTGCTGACCGCCCTCGCCCAGCTCCATGTGGACGGC
GAGAGCGTCGACTTCTCCGCCTCCTTCCCGGCCACCACCCAGGCCACCGACCTGCCCACC
TACCGCTTCGACCGCCGCCGGTACTGGCGGGACGCCCCGCAGGCGGAGGCGGACGTACGG
GCCGCGGGGCTCGAGGCGAGCGACCATCCGCTGCTGCGCGCCGCGCTCGAACCGGCGGAC
GGCGGGCTGCTGCTGACCGGCCGGCTGTCGCTGCGCGGCCAGCCCTGGCTGGCCGACCAC
GCCATCGTGGACGCGGTGCCGCTGCCCGGCACGCTCTTCGTGGAGCTCGCCCTGCAGGCC
GGGGAACGGGTCGGCTGCGACCTGATCGACGATCTCACCCTGGAGGCGCCGCTGCTGCTG
CCCCCGGTGGGTGCGGTGGACCTCCAGGTGGCCGTCGGGGCCACCGACGCGGCCGGCCGA
CGGGCCGTCACCGTCTACTCACGCCCGTCCGGCGGCGGTTCGGAGGGTTGGGAGAGTTCG
GCGGACCCGGGTGTCGCGGACGAGCCGGGCGACGGCCCGTACGGCCCGTGGCGCCGGCAT
GCCACGGCCACTCTGGGCACCGCGCCGACCGGTGTCCCCGAGCCCGCCGCGTCACCGGCG
CAGTGGCCGCCCGCCGGGGCGGAGGCGATCGACGTGGCCGGGCTGTACGAGCGGCTGGCC
GCCGAGGGCTACCGGTACGGACCGGCGTTCACGGGGTTGCGCACCGCGTGGCGGGTCGGC
GAGGAGATGTTCGCCGAGGTGGGTCTCGCCCCCGGTCAGCGCGGCGACGGCGGGGCGTAC
GCCGTCCACCCCGCGCTCCTGGACGCCGCCCTGCACCCGATCGGCGCGCTGTTCACCGGC
GAGGACCAGGCGGGCGGCGCGCCGGGCACGGTCCGGCTGCCGTTCTCCTTCGGCGGCGTA
CGGCTGCTCGCGCGCGGCGCGTCCCGGCTGCGGGTCCGGATCACGCCGACCGGACCTGAC
ACCGTGACCATGCGGCTGTCCGACGACACCGGCGCCGAGGTCGTGGCCGTCGACTCGCTC
ACGCTGCGCACCGTTTCGGCGCAGCGGTGGCGGTCCGGGGCGGTCCCGGCGGACCGGCCG
CTGTACCGGCTGGACTGGGATGCCTTCGCGCTGCCCGCCGCCGCGACAACGGCGCCGGAC
CGCTGGGCCGTACTCGCCGCCGATGACACGAACGCCACGGACACCGCCACGGCCTCGCTG
CCCGCGGAACACGTCGCGCGCCACCCCGACCTCGCCGCGCTGAGCGCGTCGGTCGCCGCC
GGGGCCCCCGCCCCCGACCTGGTCGTCATGGCCTGCCTCGGTGCCCCCTACGACACGTCC
GACGACGGCGACGAGCCGCCCTCCCAGGTGCGCACCGCCACCCATCGTGTCCTCGCGCGG
CTGCGGGAGTGGCTGACGGACGACGCCCTCGCCGCCTCCCGTCTGGTGGTCCTGACTGCC
AAAGCCGTCGCCGCCGACCCGGCCGACGCGCCGCCCGATCTGGCGGGCGCGGCGGTGCTG
GGCCTGCTGCGCGCCGCCCAGGCCGAACACCCGGGGCGGATCGTGCTGGTGGACACCGAC
GGCATCTCGGCGTCCCGGGACGCGCTGGCGGCGGCCGTGGCTGCCGCCGTGGCCGCCGGT
GAGTGGCAGCTGGCGCTGCGCGACGGGCGCGCGCTGGTGCCCCGGCTGATCCTGGCGCAC
CCCGACCCCGACGCGGCGCCGGTGGTGCTCGACCCCGACGGCACCGTGCTGGTGACCGGC
GGCACCGGGTCGCTCGGCCGGCTGCTCGCCCGCCACCTCGTCGAACATCACGGCGCCCGG
CATCTGCTGCTGGTGAGCCGGAGCGGACCGGCCGCCGAGGGCATCGAGGCGTTCGCGGCC
GGGCTCGCGGCCGACGTACGGATCGAGAGCTGCGACACCACCGACCCCGAGGCGCTGGCC
GCCCTGCTCGCCACCGTCCCCGGCGAACACCCGCTGACCGCGGTCGTGCACACCGCGGGC
GTGCTCGACGACGGCGTGGTCACCTCGCTGACGCCCGAACAGCTCGACACCGTACTGGCG
CCCAAGGTGGACGCGGCCTGGCAGTTGCACCGGCTGACCCGGGGCGCGGACCTCGCCTCG
TTCGTCCTGTTCTCGTCCGCCGCCTCCGTGCTCGGCAGCGGCGGGCAGGGCAACTACGGT
GCGGCGAACGCGTTCCTCAACGCCCTCGCCGAGCACATCCGCGCCGCGGGCGGCCCGGCC
ACCTCGCTGGCCTGGGGCCTGTGGGGCGTGGACGAGGGGATGACGGAACACCTGGCCACC
GCGGACCGGGCCCGGATGGCGCGTTCGGGCACCGCCGCGATGTCCGGGGAGGCGGGCCTG
GCCCGGTTCGACGCGGCGCTGGCCACCGCGCTGCCCGTACTGGTCCCGGCCAGGTTCGAC
CTCGCCGTGCTGCGCGAACAGGCGGCCGGCGGCGCGCTGCCTCCGCTGCTGCGCCGCCTC
GTACGCCTGCCCGTCCGTACGGCCGCGGCGGTGGAGGCGTCCCCCTCCTGGGCCGGGCGG
CTCGCCGGGCTGCCGGAGACCGAGCAGGACCGGGTGATCGGGGAGCTGATACGCGACCGG
ATCGCCGCAGTCCTGGCGCATCCGGAGCCCGAAACCCTCGAACTGGGCCGGACGTTCGCG
CAGCTCGGCCTGGACTCGCTGACCGCGCTGGAGCTGCGCAACGCGATCCATGAGGCGACG
GGGGTCCGCCTCCCGGCCACCGCCATCTTCGACTACCCGACCCCCGAGACCCTCGTCAGC
CATCTGCGCACCGAACTGCTCGGCGCCACCGCGACCACCGCGGCCACCGCGCCGCTGCCG
CCGGGGGCCGGGGCCCCGGCCCGGTCCGGGAGCGCCGACGACCCCGTCGTGATCGTCGGC
ATGGCCTGCCACTACCCGGGCGATGTGCACTCCCCTGACGAGCTGTGGCGGCTGGTGGCC
GACGGGGTGGACGCGATCGGGCCGTTCCCCGAGGACCGTGGCTGGGATGTGGCCGGGCTG
TACGACCCGGACCCCGAGCGCACCGGCAAGAGCTACACCAGGGAGGGTGGCTTCCTGCCC
GAAGCGGCCCTGTTCGACGCGGAGTTCTTCGGGATCAGCCCCCGGGAGGCGCTGGCCACC
GATCCCCAGCAGCGGCTGTTGCTGGAGACGGCGTGGCAGGCGTTCGAGCACGCCCGTATC
GATCCGGCGGCGCTGCGCGGCAGCCGTACGGCGGTGGTCACCGGCATCATGTACGACGAC
TACGGCGCGCGGTTCCTGGGCCGGATCCCGGAGGGGTACGAGGGCCAGATCATGACCGGG
TCCACGCCGAGCGTGGCGTCCGGCCGGGTGGCCTACACCTTCGGGCTGGAGGGGCCGACG
CTGACCGTGGACACGGCGTGTTCGTCGTCGCTGGTGGCGATGCACCTGGCGGCGCAGGCG
CTGCGCCAGGGGGAATGCGACCTCGCCCTGGCGGGCGGTGTGACGGTGATGGCCACGCCG
AACACGTTCATCGAGTTCTCGCGCCAGCGCGGGCTGGCGCCGGACGGGCGGTGCAAACCG
TTCGCTGCCGCCGCCGACGGCACCGGGTGGAGTGAGGGCGCCGGGCTGCTGGTGCTGGAG
CGGCTGTCGGACGCGCGCCGCAACGGGCACCGGGTGCTCGCGGTCCTGCGGGGTTCGGCG
GTCAACCAGGACGGTGCGAGCAACGGGCTGACCGCGCCCAACGGGCCGTCCCAGCAGCGG
GTGATCGGCCAGGCCCTGGCCGCGGCGGGGGTGGATCCCGCCGGGGTCGATGTGGTGGAG
GCCCATGGCACGGGCACGATGCTGGGCGACCCCATCGAGGCCCAGGCCCTGCTGGCCACA
TACGGCCGGAACCGCCCCGCAGAACAGCCCCTATGGCTGGGGTCCATCAAGTCGAACATC
GGCCACACCCAGGCCGCCGCCGGGGCCGCGGGCATCATCAAGATGGTCATGGCCCTGCGC
CACGGCCGGCTGCCCGCCACCCTGCACGTGGACGAGCCGAGCCCGCATGTGGACTGGGCG
AGCGGAAGCGTCCGGCTCCTCACCGAGGCCACCGACTGGCCGGAGGCCGACCGGCCCCGC
CGCGCCGCCGTCTCCTCTTTCGGCATCTCCGGCACCAACGCCCACCTCATCCTGGAACAG
GCCCCTGACCAGCCCGAACCGCTCCCGGAACAGTCCGAGTCAGCCACCGCGGGCGGCATC
GTGCCGTTCGTGCTCTCCGCCCGTACGGCCGAGGCGCTGCGCGCCCAGGCCGCGAACCTG
GCGGCGCGGCTCCCCTCGGCCGGGGTGGCGGAGGTGGGCTGGTCGCTGGCGACCACCCGG
TCGGCGTTCGAGCACCGGGCGGTGATCGTGGCCGAGGACCGGGACGCGCTGCTGGCCGGT
CTGGAGAAGCTGGCCGCCGACGAGCCCGATCCGGCGGTGGTGGCGGGGACGGCGACCACC
GCGGCCGCGGGCCCGGTGTTCGTCTTCCCGGGCCAGGGGTCGCAGTGGCGCGGCATGGGC
GTGGAACTGCTGGACACCTCGCCGGTGTTCGCGGCCCGGATCGCGGAGTGCGAGCGGGCC
CTGGCGCCGTACGTGGACTGGTCGCTCACCGCCGTACTGCGCGGCAGTGACACCACCACC
GACCCGCACCGCGTGGATGTCGTCCAGCCCACCCTCTGGGCCGTCATGGTGTCCCTGGCC
GCCCTCTGGCAACACCTGGGCATCGCCCCGGCCGCCGTCATCGGACACTCCCAGGGCGAG
ATCGCCGCCGCTTGTGTGGCGGGAGCCCTCACCCTCGACGACGCCGCCAAGGTCGTGGCC
CTGCGCAGCCAGGCACTGCGCGCCCTCGCCGGCCACGGCACCATGGCCTCCCTCACCCTC
GGCGCCGACGACACCGCCGGGCTCCTGGAGGAGCTGGGCGAGCGGGCCGACGACGTCACC
GTGGCCGCCGCGAACGGCCCCGTCACCACCGTCATCTCCGGTGCGGTGGAGCAGATCGCC
ACCGTTCTGGCGGCGGCCGAGGCGCACGGCGCGCGGACCCGCACCATCGATGTGGACTAC
GCCTCCCATGGGCCCCATGTCGACCGCATCCGCGAGGACATCGTCTCCGCCTTGAGCGGC
CTCGCGCCCACCGCGTCGGAGGTCGCCTTCTACTCGACGGTGACCGCCGAACGCCTGGAC
ACCGCCGGGCTCGACGCCGACTACTGGTTCACCAACCTCCGCCGCCCGGTCCGCTTCGCC
GACACCCTCGCCACTCTCCTCGCCCATGGACACCGGCACTTCATCGAGGTCAGCCCGCAC
CCCGTGCTGATCCCCGGGATGCAGGACGGTTTCGAGGCGGCCGACGCCGCCGCCACCGCC
GTCCCCACCCTCCGCCGCGACCAGGGCGGGCCCCACCAGCTCGCCCAGGCCGTGGCCCGT
GCGTACACCGCCGGTCTGGCCATCGACTGGGCCCCCTGGTATCCGGCCCGGCCGTACACC
ACCGACCTGCCCACCTACCCCTTCCAGCGCCGCCGCTACTGGCTCGGCATGGACGGCGGA
CCGGGCGATCTGCGCAGCGCCGGGCTCGTCTCGGTGTCCCACGCCCAGATCGGCGCCGCG
GTCGAACTGGCCGACGGCGGACTGGTGATGACCGGCCGGCTGCCCGCCGCCGGGAGCGGC
GGCTGGCTGGACGACCACGTCGTCGCCGACACTCCCCTGGTGCCCGGCACTGCCCTGGTG
GAGTGGGTGCTGCGAGCGGCCGACGAGGCGGGGTGCGGCGGGATCGAGGAGTTGGCGCTC
CATGTCCCGATGACACTGCCCGCGTCCGGTGGGCTGCGGATCCAGGTCGTGGCGTACGCG
CCGGACGGCGACGGCCGCCGCGAGGTACGGGTGCACTCCCGCCCCGACGCGGAGGACGGC
TCGTCACCCTGGACCTGCCACGCCACCGGACACCTCTCCCCGACCGCCCCGGGCGCCGCG
GACCCGGCCCCGGCCGGGGTGTGGCCGCCGCGGGACGCCGAACAGGTCGACGTGGCCGAC
TTCTACGGCCGCGCCGAGGCGATCGGCTACGGCTACGGACCGGCCTTCCGGGGCCTGACC
GCCGCCTGGCGGCAGGGTGACGACCTGCTCGCCGAGGTGGTGCTGCCGGAGGCGGCGCAC
GAGGGCGCCGACGGGTTCGCCCTGCACCCCGCGCTGCTCGACGCGGCCCTGCACCCCCTG
GCCCTGGACGGGCAGGGGGAGGACGGGCGGATGCGGCTGCCGTTCGCCTGGAGCGGTGTG
TCGCTGTGGGCCACCGGCGCTCGCGCGGCCCGGGTCCGGATGTCCCCGCTGGAACACGGC
TTCCGGCTGGTGGTGGCCGATGCGGCGGGCCGGCCGGTGCTCAGCGCCGAATCCGTGGTC
GTACGCCCCACCAGCGCACGGCAGTTGCGCGACGCGGGCGCGCGGCGGGTGGACGGGCTG
TACGAGGTGGCGTGGGTGGCCCTGCCGCCGTCGTCGGACACCGTCGCTGAGACGGAGACG
CGGGGCGTAGAGGGGTGGGCGCTGCTGGACGGCGGCCCGCTTCCGTTCGACCCGTCAAAG
GCCGGATCCCTGCCTCGCCACGCCGACATCGACGCCCTGCTGACCGCCCCCGCCCTGCCG
TCGACAGTGCTCGTCGGCGTTTCCGGCCCCGTGGGCGCCGCGGGCGACGAGAATTCGGCC
GAGGGCGCGTTGGCCGTGACCACCGGTGTGCTGACGTCGGCGCGGCGGTGGCTGGAGACA
CCGGAGCTGGCCGACGCCCGGCTGGTGCTGGTCACCCGGGGCGCGGTCGCGGCTGCGGAA
ACCGACGACGGCCCCGACCCTGCGGCTGCCGCGGTGTGGGGGCTGCTGCGCAGCGCACAG
GCGGAGAACCCGGGCCGTTTCCTGCTGTGCGACATCGACGACGGCGCCGGGCCCGACGAT
GTGCTCGGCGCCGTCACACGGGCGGTGGCCCTGGACGAGCCGCAGGTGGCGGTGCGCGGT
GAGCGTGTGCTGACGCCCCGTCTTGAGCGGGCGGGAGCCGCTGAGTTGGTACCGCCGCCG
GGTGAGCCTGCCTGGCGGCTGTCGGCCGATGACACCGGCACCATCGACAGCGTGTCGGTG
GTGGCCTGCCCCGAGGTGCTGGAGCCGCTGGCGCCCGGGCAGGTGCGGATCGCGGTGCGG
GCCGCGGGCATCAACTTCCGCGATGTGCTGATCGTGCTCGGGATGTATCCGGACGAGGGG
GTGTTCCGGGGCAGCGAGGGCGCGGGCGTGGTGCTGGACGTGGCCGACGATGTGACGTCG
GTGGCCGTCGGCGACCGTGTCTTCGGGCTGTTCGAGGGCGCCTTCGGGCCCGTGGCCGTC
GCCGACGCCCGCGCCGTCGTACCGGTCCCGCCGGACTGGACCGACCAGCAGGCCGCGGCC
GTCCCGACGACGTTCCTGACCGCCTGGTACGGGCTGGTGGACCTGGCCGGCCTCAAGGCG
GGCGAGTCGGTCCTCATCCATGCCGCCACGGGCGGGGTGGGCACGGCGGCCGTGCAGATC
GCCCGCCACCTGGGCGCCGAGGTGTACGCCACCGCCGGCCCCGGCAAACACGCCGTACTG
GAGGCGATGGGCATCGACGAGGCCCACCGCGCCTCCTCCCGCGACCTGGACTTCGAGGAC
GCCTTCCGCACCGCCACCGGCGGCCGCGGGGTCGACGTGATCCTCAACAGCCTCGCGGGC
GAGTACACCGACGCGTCCTTGCGGCTGTTGACCGGTGGTGGGCGCTTCATCGAGATGGGC
AAGACCGACAAGCGTGACGCCGAGCAGATCGCCGACACGTACTCCGGCGTCCGCTACCGC
TTCTACGACCTGGTGCCGGACGCCGGTCTGGACCGGGTCGCGGAGATGCTGACCACGCTG
GCCGGGCACTTCGCCCAGGGTGTTCTGGCGCCGCCGCCGGTGCGGGCGTGGCCGCTGACG
GAGGCCCGGCAGGCGCTGCGACAGATGAGCCAGGCCAGGCACACCGGCAAATACGTCCTG
GACATGCCCCGTACGCTCGACCCGGACGGCACCGTCCTGATCACCGGCGGCACCGGCACC
CTCGGCGCCCTCGTCGCCGAACACCTCGTCACCAACCACCACATCAGCCATCTCCACCTC
CTCAGCCGCCGCGGACCCGACGCCCCCGGCTCCGCCGACCTGGCGGCCCGCCTCACCGAA
CTCGGCGCCACCGTCCGCATCACCGCCACCGACACCACCGACCCGCAGGCCCTCCGGCAG
GCTCTGGACACCGTCGACCGCGACCATCCGCTCACCGGTGTCATCCACGCCGCGGGGGCG
CTGGACGACGCGGTGCTGACCGCGCAGACACCGGAGCGGCTGGCGTCGGTCTGGGCGGCG
AAGGCGACGGCCGCGGCCAATCTCCACCGGGCCACCAAGGACCTCCCCCTGGCCATGTTC
GTGATCTTCTCCTCGGCCGCCGGCACCCTCGGCACACCGGGGCAGGCCAACTACGCCGCC
GCCAACGCCTACTGCGACGCCCTCGCCGTCCGGCGACGGCGGGCGGGGCTGCCCGCCACC
TCCATCGCCTGGGGGCTGTGGGCCGCCACCAGCGAGATGACCGGGCATCTGGCGGACGCC
GATCTGGCCCGGATGAGCCGCACCGGCTTCACCCCGCTGGCCACCCCGATGGCGCTGGCC
CTGTTCGACGCCGCCGGGCGACACGGCGCCGCGACCCCGCTCGCGCTCGACCTCGATCCG
CGTACGCTCGGCGCCCAGCCGTCCGACGCCGTGCCCGCGGTGCTGCGTACGGTCGCCGCC
GCGGGAGCGCCGGTCCGGCGTACCGCCGCCGTCGCACAGTCCACCGACTGGGCCGGCCGA
CTGGCCGCGCTCTCGGCCGCCGAGCGCCACCGCGAGCTGGTCAACCTGGTACGTACGCAT
GCGGCGACGGTGCTCGGCCACAGCGACCCCGCGGCGCTCCGCGCGGACACCTCGTTCAAG
GAGCTGGGGTTCGACTCGCTGACCGCCGTCGAGCTGCGCAACCGGCTCTCGGCCGCGACC
GGTCTGCGGCTGCCCGCCGCGCTCGTCTTCGACTATCCCGACGCGGAGACCATGGCCCGC
TTCCTGGACCAGAAGCTCGCCCCCGGGGACCGGACGGAGGCGGCGGCGGTCGACCACCTC
GCCCCCGTCCTGAACGACTTGGCCCGGCTGGAGTCCACCTTGGGCAGCCATGACGTGGAC
GGGAAGGCCCGCGAGACGGTCGCGGGCCGGCTCCACGCCCTGCTGTCCCGGCTGGAGGGG
AGCACGGCCAGTGCGGCGGACATCGACGGCGAGGCGCTGGAGTCCGCCTCGGACGACGAG
ATGTTCGCGCTCATCGACCAGCAACTGGGCTCGTCCTGA
[3] KS42..415
[3] AT576..921
[3] malonyl-CoA775..779
[3] DH969..1153
[3] KR1494..1671
[3] ACP1773..1843
[4] KS1874..2251
[4] AT2406..2727
[4] methylmalonyl-CoA2600..2604
[4] DH2774..2939
[4] ER3273..3580
[4] KR3590..3770
[4] ACP3873..3943
[3] KS124..1245
[3] AT1726..2763
[3] malonyl-CoA2323..2337
[3] DH2905..3459
[3] KR4480..5013
[3] ACP5317..5529
[4] KS5620..6753
[4] AT7216..8181
[4] methylmalonyl-CoA7798..7812
[4] DH8320..8817
[4] ER9817..10740
[4] KR10768..11310
[4] ACP11617..11829

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [569-707]  G3DSA:3.40.366.10 [775-912]  G3DSA:3.40.366.10 [2397-2529]  G3DSA:3.40.366.10 [2600-2717]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1494-1657]  3.09999999999998e-58 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1801-1816]  PS00012 [3901-3916]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1773-1843]  PS50075 [3873-3943]  PS50075
PS50075   ACP_DOMAIN
 [1766-1890]  1.29999924468179e-25 SSF47336 [3864-3950]  5.10001002358244e-23 SSF47336
SSF47336   ACP_like
 [1776-1842]  1.2e-12 PF00550 [3877-3942]  8.9e-12 PF00550
PF00550   PP-binding
 [1773-1846]  7.69999999999997e-45 G3DSA:1.10.1200.10 [3871-3947]  7.69999999999997e-45 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR011032 GroES-like (Domain)
 [3264-3408]  2.49999811956465e-31 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [3412-3505]  4.10000000000001e-18 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [3292-3348]  2.4e-07 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [3590-3769]  2.19999999999997e-58 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [42-290]  1.10000000000001e-89 PF00109 [1874-2125]  1.79999999999997e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [298-415]  5.49999999999995e-44 PF02801 [2133-2251]  1.70000000000001e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [576-921]  1.99999999999999e-69 PF00698 [2406-2727]  6.20000000000009e-100 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [7-42]  1.40000045763982e-07 SSF101173
SSF101173   Polyketide_synth_docking
 [10-35]  4.00000000000001e-11 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [573-885]  2.59998233910302e-70 SSF52151 [2404-2709]  1.10000150671643e-64 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [709-774]  6.90001478563507e-18 SSF55048 [2531-2599]  2.00000075217456e-14 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [41-301]  G3DSA:3.40.47.10 [302-468]  2.20000000000002e-128 G3DSA:3.40.47.10 [1876-2137]  G3DSA:3.40.47.10 [2138-2304]  2.20000000000002e-128 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [34-405]  2.39999798157263e-99 SSF53901 [1866-2249]  7.49999605851445e-105 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1493-1691]  3.60000000000002e-66 G3DSA:3.40.50.720 [3409-3505]  5.90000000000001e-21 G3DSA:3.40.50.720 [3590-3774]  1e-67 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [203-219]  PS00606 [2038-2054]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [577-902]  7.6999848053369e-128 SM00827 [2408-2708]  1.69998802370953e-111 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1774-1846]  3.1999989904635e-27 SM00823 [3874-3946]  2.49999811956465e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [969-1153]  2.0000139277205e-75 SM00826 [2774-2939]  1.69998802370953e-71 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [44-468]  SM00825 [1876-2303]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1494-1671]  4.30000170645869e-52 SM00822 [3590-3770]  6.60002751141562e-54 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [3273-3580]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit