close all open/close all

CDS information : Nanch_00140


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction66,747 / 65,365 / - [in whole cluster]
66,747 / 65,365 / - [in contig]
Locationcomplement(65365..66747) [in whole cluster]
complement(65365..66747) [in contig]
TypeCDS
Length1,383 bp (460 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Product4-O-methyl-L-rhodinose glycosyltransferase
Product (GenBank)NanG5
Gene
Gene (GenBank)nanG5
EC number
Keyword
Note
Note (GenBank)
  • putative glycosyltransferase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
[18482697] Mechanism of thioesterase-catalyzed chain release in the biosynthesis of the polyether antibiotic nanchangmycin. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>4-O-methyl-L-rhodinose glycosyltransferase [NanG5]
MRSMTKVHGRESELVAIAGDQRGEMPAMRVLFVTIPWRTHFQFCVPMAWALRTAGHEVHV
ASGPDLTDVIVQSGLTAVPVGSEEHFLEKAHQAQTEASEATWGGIHHPIDLGENREEMFP
LSYLKSLCATSTEVAKAVNDSMIDDLVAYCRWWKPDLVVWEWLSHAGAVAAAAVGAAHAR
MPIGIEVEARMRRHFLKLLAQQEPADREDPMAEWLGAWGEKHGFEFREELVTGQFTIDQV
PDSMRLKANVPQVSVRHVPYNGRAVAPDWIRPEPPAPRVLATFGMSMWDMSSSQPVSSYQ
MVSIEQLQDWLDSMADLEMELVMTLPGRIQEKLKHVPQNTRLVDFVPLHLVIPSCAAVIH
HGGLPAFCSSLAHGVPQLMVSRMAPDASVRGARLEEAQAGGWIPPERMTGKRIRNHLAKL
VQDPSYRAGAERLRQEVLAQPSPNEVVPELERLTEELRSR
selected fasta
>4-O-methyl-L-rhodinose glycosyltransferase [NanG5]
GTGCGGTCAATGACGAAGGTGCACGGGCGAGAGAGCGAACTGGTTGCCATTGCCGGTGAC
CAGAGAGGAGAGATGCCAGCCATGCGTGTCCTGTTCGTCACCATTCCTTGGCGGACCCAC
TTCCAGTTCTGTGTGCCGATGGCCTGGGCCCTGCGCACCGCGGGCCACGAGGTTCATGTC
GCCAGCGGCCCCGACCTCACCGACGTCATCGTCCAGTCAGGGCTGACGGCGGTCCCGGTC
GGATCGGAGGAGCACTTCCTGGAGAAGGCGCACCAAGCGCAGACGGAAGCATCCGAAGCG
ACATGGGGTGGAATTCACCATCCCATCGATCTGGGCGAGAATCGCGAAGAGATGTTTCCG
CTGAGCTACCTGAAGTCGCTCTGCGCCACTTCCACCGAAGTGGCCAAGGCCGTGAACGAT
TCGATGATCGACGATCTGGTCGCGTACTGCCGCTGGTGGAAGCCCGACCTGGTGGTCTGG
GAGTGGCTGAGCCACGCGGGGGCGGTCGCCGCCGCCGCGGTGGGGGCGGCACACGCGCGG
ATGCCGATCGGTATCGAGGTGGAGGCCCGTATGCGCCGCCACTTCCTGAAGCTGCTGGCG
CAGCAGGAGCCGGCGGACCGCGAGGACCCCATGGCCGAATGGCTCGGCGCGTGGGGGGAG
AAACACGGTTTCGAGTTCCGCGAAGAGCTGGTGACCGGCCAGTTCACGATCGACCAGGTG
CCGGACTCCATGAGGCTCAAAGCCAATGTGCCGCAGGTCTCCGTCCGCCATGTGCCGTAC
AACGGCCGCGCCGTCGCGCCGGACTGGATCCGCCCTGAGCCGCCGGCGCCGCGTGTCCTC
GCCACATTCGGGATGAGCATGTGGGACATGTCCAGCTCGCAGCCCGTCTCCAGCTACCAG
ATGGTCTCCATTGAGCAGCTGCAGGACTGGCTCGACTCGATGGCCGATCTCGAGATGGAA
CTGGTGATGACCCTGCCGGGGAGAATCCAGGAAAAACTGAAGCACGTCCCCCAGAACACC
AGGCTTGTCGATTTCGTCCCGCTGCACCTCGTCATTCCGTCCTGTGCGGCGGTGATTCAC
CACGGCGGACTTCCCGCCTTCTGCAGCTCGCTGGCGCACGGCGTCCCACAGCTCATGGTC
AGCCGTATGGCCCCCGACGCCTCGGTGCGAGGCGCACGGCTGGAAGAGGCCCAGGCGGGT
GGGTGGATCCCGCCGGAGCGCATGACAGGAAAGCGAATCCGGAATCACCTGGCGAAGCTG
GTGCAAGACCCCTCCTACCGGGCGGGTGCCGAGCGGCTCCGTCAGGAGGTGCTGGCTCAG
CCGTCCCCCAACGAGGTGGTCCCCGAACTGGAACGGCTGACGGAGGAGCTCCGTTCTCGC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [30-169]  1.7e-12 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [237-341]  2.7e-22 PF06722
PF06722   DUF1205
SignalP No significant hit
TMHMM No significant hit