close all open/close all

CDS information : Nanch_00150


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction66,881 / 67,798 / + [in whole cluster]
66,881 / 67,798 / + [in contig]
Location66881..67798 [in whole cluster]
66881..67798 [in contig]
TypeCDS
Length918 bp (305 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose O-methyltransferase
Product (GenBank)NanM
Gene
Gene (GenBank)nanM
EC number2.1.1.-
Keyword
  • 4-O-methyl-L-rhodinose
Note
Note (GenBank)
  • putative methyltransferase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q2I754
PmId
[16632249] Biosynthesis of the terpene phenalinolactone in Streptomyces sp. Tu6071: analysis of the gene cluster and generation of derivatives. (Chem Biol. , 2006)

close this sectionSequence

selected fasta
>putative NDP-hexose O-methyltransferase [NanM]
MAQGFQASLQWERINELWVTEEASADLTGFKSDRRNFNIALWDPTTNGIRYLRALVYELA
TRLSDDDWSKIEKVRNRDVGDPVTVRYEGRTVCLDYLQAALELGFIEKELDLGGARVLEI
GAGYGRTCHAMLSNYDLASYTIVDLKNTLGLSRAYLREVLDEKQFSKMRFVQVEDIDTGL
GPDGFDLCVNVHSFTEMTPDTVKAYLRLIDERCGAFFVKNPVGKFRDKSMDGHQKGEEAV
RLAMQTGPLRQVLDIHDSQAVAAAVPAFIEAYQPGEGWTCAANTRGMPWSYFWQALYTKT
GDDLR
selected fasta
>putative NDP-hexose O-methyltransferase [NanM]
ATGGCTCAGGGTTTTCAGGCCAGCCTGCAGTGGGAACGCATCAATGAACTCTGGGTTACC
GAGGAGGCGTCGGCTGATCTGACCGGCTTCAAGTCGGACCGCCGGAATTTCAATATCGCC
CTGTGGGATCCGACGACCAACGGAATCAGGTATCTGAGGGCTCTCGTCTACGAGTTGGCC
ACGCGGCTGAGCGACGACGACTGGTCGAAGATCGAGAAAGTCCGCAACCGTGACGTGGGA
GATCCGGTCACCGTCCGATACGAGGGCAGGACCGTCTGTCTGGACTATCTCCAGGCGGCG
CTCGAGCTCGGCTTCATCGAGAAGGAACTGGACCTGGGCGGCGCCCGCGTCCTGGAGATC
GGCGCCGGGTACGGCCGTACGTGCCATGCGATGCTCTCCAACTACGACCTGGCCTCCTAC
ACCATCGTCGACCTGAAGAACACCCTCGGGCTGAGCAGGGCGTATCTTCGCGAGGTCCTG
GACGAGAAGCAGTTCTCCAAGATGAGGTTCGTCCAGGTGGAGGACATCGACACGGGGCTG
GGCCCGGACGGCTTCGACCTGTGCGTCAACGTGCACTCCTTCACGGAGATGACCCCGGAC
ACCGTCAAGGCGTATCTGCGCCTGATCGACGAGAGGTGCGGGGCGTTCTTCGTGAAGAAC
CCGGTCGGAAAGTTCCGGGACAAGAGCATGGACGGCCACCAGAAGGGCGAGGAGGCCGTG
CGGCTGGCCATGCAGACCGGGCCGCTGCGGCAGGTGCTCGACATCCATGACAGCCAGGCC
GTGGCGGCCGCCGTGCCGGCCTTCATCGAGGCCTATCAGCCCGGCGAGGGATGGACGTGC
GCCGCCAACACCCGCGGCATGCCCTGGAGTTACTTCTGGCAGGCCCTCTACACGAAGACC
GGCGACGACCTTCGATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003333 Mycolic acid cyclopropane synthase (Family)
 [113-211]  9.5e-05 PF02353
PF02353   CMAS
SignalP
 [1-25]  0.103 Signal
Eukaryota   
TMHMM No significant hit