close all open/close all

CDS information : Nanch_00160


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction67,823 / 68,863 / + [in whole cluster]
67,823 / 68,863 / + [in contig]
Location67823..68863 [in whole cluster]
67823..68863 [in contig]
TypeCDS
Length1,041 bp (346 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NanG4
Gene
Gene (GenBank)nanG4
EC number
Keyword
  • 4-O-methyl-L-rhodinose
Note
Note (GenBank)
  • NDP-D-glucose-4,6-dehydratase; NDP-D-glucose-4-epimerase; NDP-D-glucose-4-reductase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q9L4S7
NITE
Urd_00230
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NanG4]
MAASPVPPPRGDEALAGTPVLVLGGSGYLGRHICSAFGAAGAQVVPVSRGARGGVDGDGC
RSVRLDLTAAGPDELARLCAGTGARVLVNASGAVWGGGERQMAEANTELVGRLAGAVARL
PGRPRLIHLGSAYEYGPARPGTAIAEDWPPAPTTVYGRTKLSGSQAVLRAAAELGVAGTV
LRVSVACGPGAPVSSLAGAVAAHLAAGRDELRLAPLRDHRDLVDVRDVADAVVAAAVAPV
AAVTGTVVNIGSGQAVPVRRLVDLMIALSGRPVRVIEDPALRRTRSDAAWQRLDIGRARR
LLGWAPRRTLRESLRDLLAAVGAPQPAAVRAATAIGPRNSHGKDSR
selected fasta
>putative NDP-hexose C-4 ketoreductase [NanG4]
ATGGCCGCCTCTCCGGTGCCCCCGCCCCGCGGTGACGAAGCGCTGGCCGGCACGCCGGTC
CTGGTCCTGGGCGGCTCCGGCTACCTGGGGCGGCACATATGCTCGGCGTTCGGTGCCGCG
GGCGCCCAGGTGGTGCCGGTCTCGCGCGGCGCGCGCGGCGGCGTGGACGGTGACGGCTGC
CGCTCGGTGCGCCTGGATCTGACCGCGGCCGGGCCCGATGAGCTGGCCCGGCTGTGCGCC
GGTACAGGGGCGCGGGTGCTGGTGAACGCCTCGGGCGCGGTCTGGGGCGGTGGCGAACGG
CAGATGGCCGAGGCCAACACCGAGCTGGTCGGCCGGCTGGCCGGGGCCGTCGCCCGATTG
CCGGGCCGGCCGCGGCTGATTCACCTGGGCAGCGCCTACGAGTACGGCCCGGCCCGCCCG
GGGACCGCGATCGCGGAGGACTGGCCGCCCGCCCCGACCACCGTCTACGGCCGCACCAAG
CTGAGCGGCTCGCAGGCCGTCCTTCGGGCCGCCGCCGAGCTCGGTGTCGCCGGAACCGTG
CTGCGGGTCTCCGTCGCCTGCGGCCCGGGCGCCCCGGTGAGCAGCCTCGCCGGGGCGGTG
GCCGCGCACTTGGCGGCCGGCCGCGACGAGTTGCGGCTCGCGCCCCTGCGCGACCACCGC
GACCTGGTGGACGTCCGGGACGTGGCCGACGCGGTGGTCGCGGCGGCCGTGGCACCGGTC
GCCGCCGTCACCGGCACAGTCGTCAACATCGGCAGCGGCCAGGCGGTGCCCGTGCGCCGG
CTGGTCGATCTGATGATCGCCCTCAGCGGGCGCCCGGTGCGTGTCATCGAGGACCCCGCG
CTGCGCCGGACGCGTTCCGACGCGGCCTGGCAGCGACTGGACATCGGACGTGCGCGGCGC
CTGCTGGGCTGGGCGCCGCGCCGAACCCTGCGGGAGTCACTGCGCGATCTGCTCGCCGCC
GTCGGCGCGCCGCAGCCCGCGGCGGTACGAGCGGCGACAGCGATCGGACCCCGGAACAGT
CATGGGAAGGACAGCAGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [20-251]  1.4e-32 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [20-223]  1.9e-27 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit