close all open/close all

CDS information : Nanch_00170


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction68,860 / 70,164 / + [in whole cluster]
68,860 / 70,164 / + [in contig]
Location68860..70164 [in whole cluster]
68860..70164 [in contig]
TypeCDS
Length1,305 bp (434 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase
Product (GenBank)NanG3
Gene
Gene (GenBank)nanG3
EC number
Keyword
  • 4-O-methyl-L-rhodinose
Note
Note (GenBank)
  • putative NDP-D-glucose-3,4-dehydratase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q9L4S6
NITE
Urd_00240
PmId
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)
[17434221] Surprising production of a new urdamycin derivative by S. fradiae Delta urdQ/R. (J Biotechnol. , 2007)
ACC
Q9ALN8
NITE
Spino_00050
PmId
[17076492] Characterization of SpnQ from the spinosyn biosynthetic pathway of Saccharopolyspora spinosa: mechanistic and evolutionary implications for C-3 deoxygenation in deoxysugar biosynthesis. (J Am Chem Soc. , 2006)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [NanG3]
MSERVARILDEVRKYHQDSQEGRGFIPGVTEIWPSGAVLDEDDRVALVQAALEMRIAAGK
LSRKFESAFARRMKRRKAHLTNSGSSANLLAISALTSHLLGERRLRPGDEVITVAASFPT
TVNPILQNGLVPVYVDVELGTYNATAERVAEAIGPRTRAIMMAHTLGNPFQATEMARLAQ
DHDLILIEDSCDAVGSTYDGRPAGTFGDLTTVSFYPAHHLTMGEGGCVLTSNLVLARIVE
SLRDWGRDCWCEPGESDTCRKRFGYQMGTLPAGYDHKYIFSHIGYNLKSTDLQAALGLTQ
LDKLDAFCSARRSNWRRLREGLDGLPWLILPEATPRSDPSWFGFVLTVDPRAPFSRAELV
DFLESRKIGTRRLFAGNLTRHPAHAEAPHRVCGDLANSDTVTEHTFWVGVYPGLTEEMID
FMVSSITEFIGSHR
selected fasta
>putative pyridoxamine 5'-monophosphate-dependent NDP-hexose C-3 dehydratase [NanG3]
ATGAGCGAACGGGTCGCGCGCATCCTCGACGAGGTGCGCAAGTACCACCAGGACAGCCAG
GAGGGGCGTGGCTTCATCCCCGGGGTCACCGAGATCTGGCCCTCGGGCGCGGTGCTCGAC
GAGGACGACCGGGTCGCGCTGGTGCAGGCCGCGCTGGAGATGCGGATCGCCGCGGGCAAG
CTCTCCCGGAAGTTCGAGTCGGCCTTCGCGCGCCGGATGAAGCGCCGCAAGGCACACCTG
ACGAACTCCGGGTCGTCCGCGAACCTCCTCGCGATCTCCGCGCTGACCTCCCACCTGCTG
GGCGAGCGCCGGCTGCGCCCGGGCGACGAGGTCATCACGGTGGCGGCGAGCTTCCCCACC
ACCGTCAACCCGATCCTGCAGAACGGGCTTGTCCCGGTCTATGTGGACGTCGAGTTGGGG
ACGTACAACGCCACGGCCGAGCGGGTGGCGGAGGCGATCGGGCCGCGCACCCGGGCCATC
ATGATGGCGCACACGCTGGGCAACCCCTTCCAGGCCACGGAGATGGCCCGGCTGGCGCAG
GACCACGACCTGATTTTGATCGAGGACAGCTGCGACGCCGTGGGCTCCACCTATGACGGG
CGGCCGGCCGGGACGTTCGGCGATCTGACGACCGTCAGCTTCTACCCCGCGCACCATCTG
ACCATGGGTGAGGGCGGCTGCGTGCTGACCTCGAACCTGGTCCTGGCGCGGATCGTGGAG
TCGCTGCGGGACTGGGGCCGGGACTGCTGGTGCGAGCCGGGCGAGAGCGACACATGCCGC
AAGCGGTTCGGGTACCAGATGGGCACGCTGCCGGCCGGCTACGACCACAAGTACATCTTC
TCCCACATCGGGTACAACCTGAAGTCGACCGACCTCCAGGCGGCGCTCGGGCTGACCCAG
CTCGACAAGCTCGACGCGTTCTGCTCGGCCCGTCGGAGCAACTGGCGGCGGCTGCGCGAA
GGGCTGGACGGGCTGCCGTGGCTGATCCTGCCGGAGGCGACGCCGCGCTCCGATCCGAGC
TGGTTCGGGTTCGTCCTGACCGTCGATCCGCGGGCCCCGTTCAGCCGCGCCGAGCTGGTC
GACTTCCTGGAGTCCCGCAAGATCGGCACACGTCGGCTGTTCGCCGGGAACCTGACGCGC
CATCCCGCGCATGCCGAAGCGCCACACCGGGTGTGCGGCGATCTGGCCAACAGCGACACC
GTCACCGAGCACACGTTCTGGGTCGGCGTCTATCCAGGGCTGACCGAGGAGATGATCGAC
TTCATGGTCTCCTCCATCACCGAGTTCATCGGGAGCCACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [42-426]  2.70000000000002e-96 PF01041
PF01041   DegT_DnrJ_EryC1
 [1-434]  7.80005155399507e-110 PIRSF000390
PIRSF000390   PLP_StrS
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [30-302]  9.69999999999989e-69 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [303-426]  1.40000000000001e-48 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [30-433]  3.10001307370203e-92 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP No significant hit
TMHMM No significant hit