close all open/close all

CDS information : Nanch_00180


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction71,140 / 70,145 / - [in whole cluster]
71,140 / 70,145 / - [in contig]
Locationcomplement(70145..71140) [in whole cluster]
complement(70145..71140) [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)NanG2
Gene
Gene (GenBank)nanG2
EC number4.2.1.46
Keyword
  • 4-O-methyl-L-rhodinose
Note
Note (GenBank)
  • dTDP-D-glucose-4,6-dehydratase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q194R3
NITE
Mith_00070
PmId
[9150235] Cloning and insertional inactivation of Streptomyces argillaceus genes involved in the earliest steps of biosynthesis of the sugar moieties of the antitumor polyketide mithramycin. (J Bacteriol. , 1997)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [NanG2]
MKLLVTGAAGFIGSTYARRLLARGGAEWGPDVSHVTVLDKLTYAGTLSNLDTADPRLTFV
HGDICDADLVDTLMARANQVVHFAAESHVDRSITGADPFVRTNVEGTHTLLQAALRHGVE
RFVHVSTDEVYGSVETGFSPETAVLDPNSPYAASKAASDLIALAYHRTHGLDVRVTRCSN
NYGPHQFPEKIIPLFITNLLDGEDVPLYGDGLNVRDWLHVEDHCRGVELVRTKGSPGEIY
NIGGGTALTNRELTGRLLDACGAGWSRVRYVEDRKGHDRRYAVQDDKARDELGYRPRHDF
AAGLAETVAWYRDNRPWWEPLKRSALTGGSR
selected fasta
>putative dTDP-glucose 4,6-dehydratase [NanG2]
ATGAAGCTCCTGGTCACAGGTGCCGCGGGGTTCATCGGGTCCACCTATGCACGCAGGCTC
CTCGCACGGGGCGGCGCGGAGTGGGGCCCCGACGTCTCACATGTCACCGTGCTGGACAAG
CTCACCTACGCGGGGACACTGAGCAACCTCGACACCGCCGACCCCCGGCTGACGTTCGTG
CACGGCGACATCTGCGACGCCGACCTGGTCGACACGCTGATGGCGCGGGCCAACCAAGTG
GTGCACTTCGCCGCCGAATCCCACGTCGACCGCTCCATCACCGGCGCCGACCCGTTCGTG
CGCACCAATGTCGAGGGCACCCACACGCTGCTGCAGGCGGCCCTGCGCCACGGGGTGGAG
CGTTTCGTCCATGTCTCCACCGACGAGGTCTACGGCTCGGTCGAGACCGGATTCAGCCCC
GAGACCGCCGTACTGGACCCCAACTCGCCGTACGCCGCCTCCAAGGCCGCCTCCGACCTG
ATCGCCCTCGCCTACCACCGCACCCATGGGCTGGACGTACGCGTCACCCGGTGCAGCAAC
AACTACGGGCCCCACCAGTTCCCGGAAAAGATCATCCCGCTGTTCATCACCAACCTGCTC
GACGGCGAGGACGTGCCGCTGTACGGCGACGGGCTGAACGTGCGCGACTGGCTGCACGTG
GAGGACCACTGCCGCGGCGTGGAACTGGTGCGCACCAAGGGATCGCCCGGCGAGATCTAC
AACATCGGCGGCGGCACCGCGTTGACCAACCGGGAGCTGACCGGTCGGCTGTTGGACGCC
TGCGGCGCCGGCTGGAGCCGCGTACGGTACGTCGAGGACCGCAAGGGGCACGACCGGCGC
TACGCGGTCCAGGACGACAAGGCCAGGGACGAACTCGGCTACCGCCCGCGCCACGACTTC
GCGGCCGGGCTGGCCGAGACGGTCGCCTGGTACCGGGACAACCGCCCCTGGTGGGAGCCG
CTCAAACGCTCCGCGCTCACCGGTGGCTCCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [4-243]  5.09999999999993e-67 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [2-321]  2.70000000000002e-122 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [1-199]  1.9e-64 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-17]  0.369 Signal
Bacteria, Gram-negative   
 [1-17]  0.949 Signal
Eukaryota   
 [1-22]  0.328 Signal
Bacteria, Gram-positive   
TMHMM No significant hit