close all open/close all

CDS information : Nanch_00190


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction72,045 / 71,137 / - [in whole cluster]
72,045 / 71,137 / - [in contig]
Locationcomplement(71137..72045) [in whole cluster]
complement(71137..72045) [in contig]
TypeCDS
Length909 bp (302 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)NanG1
Gene
Gene (GenBank)nanG1
EC number2.7.7.24
Keyword
  • 4-O-methyl-L-rhodinose
Note
Note (GenBank)
  • putative glucose-1-phosphate thymidylyltransferase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
P26393
PmId
[8382158] Purification, characterization and HPLC assay of Salmonella glucose-1-phosphate thymidylyl-transferase from the cloned rfbA gene. (Eur J Biochem. , 1993)
ACC
P37744
PmId
[11697907] Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase. (J Mol Biol. , 2001)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NanG1]
MKGIILAGGNGTRLQPLTLAGSKQLVPVYDKPMIYYPLSVLMFAGIRDILIISRPTELPQ
FRQLFGDGRRLGLNLSYASQEKPRGIADAFRIGADHIRGEECALILGDNLFHGANLPALL
RRSVQRLRGCVLFGHEVADPRHFGVAEIDERGRLLSIEEKPERPRSNLAIPGLYLFDGGV
VDVAKRLVPSARGELEITDVLRAYLEEGTADLVWLGRGVTWLDTGTHETLLDAGRMVRDV
QHYQGTRLGCVEEIAMYMGFIGADECYTLGTEMSNSPYGQYVMDRARSYRRGLPPARFLE
EI
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NanG1]
ATGAAGGGCATCATTCTCGCGGGCGGGAACGGAACACGGCTGCAGCCCCTCACCTTGGCG
GGGTCGAAACAGTTGGTTCCCGTTTACGACAAACCCATGATCTACTATCCGCTGTCCGTT
CTCATGTTCGCGGGCATCCGGGATATCCTGATCATCAGTCGCCCCACCGAGCTGCCTCAA
TTCCGCCAGCTTTTCGGAGACGGCCGGCGCCTGGGGCTGAACCTCTCTTATGCCTCCCAG
GAGAAACCGCGGGGAATCGCCGACGCCTTCCGGATCGGCGCGGATCATATTCGCGGAGAG
GAGTGCGCGCTGATCCTGGGCGACAACCTCTTCCACGGCGCGAATCTGCCCGCGCTGCTC
CGTAGAAGTGTGCAGCGGCTGCGCGGATGCGTGCTGTTCGGGCACGAGGTCGCCGATCCC
CGGCACTTCGGCGTCGCCGAAATCGACGAGCGCGGCAGGCTGCTGTCCATCGAGGAGAAG
CCCGAGCGGCCCCGGTCGAACCTGGCCATTCCCGGCCTGTACCTCTTCGACGGCGGCGTC
GTCGACGTGGCCAAGCGCCTGGTGCCCTCGGCCCGGGGCGAACTGGAGATCACGGACGTC
CTGCGCGCCTATCTCGAGGAGGGCACGGCCGATCTGGTGTGGCTCGGCAGGGGTGTCACC
TGGCTGGACACCGGCACCCACGAGACCCTCCTGGACGCGGGCCGTATGGTGCGCGACGTT
CAGCACTACCAAGGCACGCGGCTCGGCTGCGTCGAGGAGATCGCCATGTACATGGGATTC
ATCGGAGCCGACGAGTGCTACACCCTCGGCACCGAGATGAGCAACTCACCCTACGGCCAG
TACGTCATGGACCGGGCGCGCTCGTACCGGCGGGGCCTGCCGCCCGCGCGCTTTCTGGAG
GAGATATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [2-237]  8.30000000000004e-59 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [2-284]  5.00000000000001e-115 TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit