close all open/close all

CDS information : Nanch_00200


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction76,990 / 72,050 / - [in whole cluster]
76,990 / 72,050 / - [in contig]
Locationcomplement(72050..76990) [in whole cluster]
complement(72050..76990) [in contig]
TypeCDS
Length4,941 bp (1,646 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NanA7
Gene
Gene (GenBank)nanA7
EC number
Keyword
Note
Note (GenBank)
  • PKS
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)

close this sectionPKS/NRPS Module

10 methylmalonyl-CoA
KS35..411
AT567..889
KR1213..1392
ACP1495..1565

close this sectionSequence

selected fasta
>polyketide synthase [NanA7]
MANDDKKLLDYLKRVTADLREAQRRLKDVEYARHEPVAIIGIGCRFPGDAGSPEDLWDLV
AAGREGTGGLPADRGWDLEALYDPEPGHPGTSYVREGGFLRDAARFDAAFFGISPNEAVT
MAPQQRLALELAWEAVEHARIDPHTLRSSATGTYLGCDGLDYFLNSFQVPEGAAGQLTTG
NSPSVVAGRVSYTLGLEGAAVTLDTACSSALVAIHLACQALREEEVTLALAGGVYVMSSP
APLVGFSELRALAPDGRAKPFSADADGMNLAEGAGVVLLERLSDARRNGHEVLAVIRGSA
VNEDGASNGLTAPNGPSQQRVIQQALANARLAPADVDAVEAHGTGTSLGDPIEAQALLAT
YGQDRPEGRPLWLGSIKSNIGHTQIAAGAAGVIKMVMALRHGMLPRSLHIDEPTPHVAWD
TGGVRLLDQAVEWPRAERPRRAGVSAFGFSGTNAHLILEEAPEPAPPANESAEPAEPAAL
VTPWVLSARSAAALRRQARRLLDAATDGDPRAVGWSLVTTRSVFEHRAVVTGPDGATLRE
RLAALAAGEPAPHVVTGAPGAPGAGVVLVFPGQGSQWPGMGAELLDASPVFAARIAECEA
ALAPYVDWSLTEVLRGADGAADLGRVDVVQPVLWALMVSLAALWAHHGVRPAAVVGHSQG
EIAAACVAGALTLEDGARVVALRSQALRALAGRGAMASLGVDPDTAERLVAEVGEKAAGV
GVAALNSPSSTVVSGPPDAVAAVVAACEATGARARTIDVDYASHGPQVDEIADEVTARLA
GVGGQATDVAFYSTVTGGPMDTATALDAGYWLTNLRRPVRLTEAVDALLTAGHRVFIEVS
THPVVVPALQQCFESAQVAAVAMGTLRRDEGGPAQLATALAQAFTSGVPVDWRPWFDGPP
APRTTALPTYAFDRERYWLPPARAVRGDGAQDPAEAELWGAIEDLDTEALARVLEPDGTA
EDIEALRPALPVLSTWRRRHRERTTLESWRHQIRWTPLPDPAPPAVSSTWLLLVPTGYED
HPAVRTVTGALTGHGAEVRPCPADPSVTSRAELAERLTGLRGDDAPAGVVSLLALDERPR
ADHPAVPAGLAATVAALQALGDAGITAPLWCVTQGAVSTGHDDPLSHPLQAQTWGLGRVA
ALEHPDRWGGLVDLPAEPDERTEAQLAALLAGAPTGGQAEDQVAIRAGGGALARRLVHTT
SARTADQAWQPRGSVLITGGTGGVGALLARWAAERGAAQLVLTSRRGPNAPGAAELAAEL
RGLGVAVTIAACDAADPEAMRGVLDAIPAEHPLSAVIHAAGVSEQDLIADVDDEHLNRML
APKALAAWHLHELTRHLDLSAFILFSSVSASWGSGQQAGYAAANAYLDALAEHRRGLGLP
TTSVAWGLWGEVGMATTADEVDAFRRRGIHPLDPGLAIASLQQAVERRETNAVVAAIDWR
RFLTGFTALRPSPLLSDLPEAAEARAEETRPREDEADPLRRKLAGCPPAEQHHILVRHVQ
AHAATTLGHADADAVPPTKPFQELGFDSLTAVQLRDRLNAGTGLRLPTTVLFDYPSAEEL
ARHLHGLLVADAASGEQLIMSELDGWDAAHAPDTVDEAACSRIAARLRLLADKWSDTARA
TGSHSDLETATAEDIFDLIATEFGKS
selected fasta
>polyketide synthase [NanA7]
ATGGCGAACGACGACAAGAAGCTCCTCGACTACCTCAAGCGCGTGACGGCCGATCTGCGC
GAGGCCCAGCGCCGGCTGAAGGACGTCGAGTACGCCCGCCACGAACCCGTCGCGATCATC
GGTATCGGCTGCCGTTTCCCCGGCGATGCGGGGTCCCCCGAGGACCTGTGGGACCTGGTC
GCCGCCGGCCGCGAGGGCACCGGCGGCCTGCCCGCCGACCGAGGCTGGGACCTCGAAGCG
CTCTACGACCCCGAACCCGGGCATCCGGGCACCAGCTATGTGCGCGAGGGCGGCTTCCTC
CGCGACGCCGCCCGGTTCGACGCCGCGTTCTTCGGGATCAGCCCGAACGAAGCGGTCACC
ATGGCCCCGCAGCAGCGGCTGGCGCTGGAGCTGGCCTGGGAAGCCGTCGAGCACGCCCGC
ATCGACCCGCACACCCTGCGCTCCAGCGCCACCGGCACCTACCTCGGCTGCGACGGCCTC
GACTACTTCCTCAACTCCTTCCAGGTGCCCGAGGGCGCGGCGGGCCAGCTGACCACCGGC
AACTCGCCGAGCGTGGTCGCCGGACGCGTGTCGTACACCCTCGGCCTGGAGGGCGCCGCG
GTGACGCTGGACACCGCCTGCTCCTCGGCGCTGGTCGCCATCCACCTGGCGTGCCAGGCG
CTGCGGGAGGAAGAGGTGACGCTGGCGCTGGCCGGTGGGGTGTACGTGATGTCCTCACCG
GCACCGCTGGTCGGGTTCAGCGAGCTGCGCGCCCTGGCCCCGGACGGCCGTGCCAAGCCC
TTCTCGGCGGACGCCGACGGCATGAACCTCGCCGAGGGCGCCGGTGTGGTGCTCCTGGAG
CGGCTGTCGGACGCACGCCGCAACGGCCACGAGGTGCTGGCGGTCATCCGTGGCTCCGCC
GTCAACGAGGACGGTGCCAGCAACGGTCTGACCGCGCCGAACGGGCCGTCACAGCAGCGC
GTCATCCAGCAGGCGCTGGCCAACGCCCGGCTCGCGCCGGCGGACGTGGACGCGGTGGAG
GCACACGGGACGGGCACCAGCCTCGGCGATCCCATCGAGGCCCAGGCGCTGCTGGCCACC
TACGGCCAGGACCGGCCCGAGGGGCGGCCGCTGTGGCTGGGGTCGATCAAGTCCAACATC
GGCCACACCCAGATCGCCGCCGGTGCCGCCGGCGTGATCAAGATGGTCATGGCGCTGCGC
CACGGGATGCTGCCGCGCTCCCTGCACATCGACGAGCCCACCCCGCATGTGGCCTGGGAC
ACCGGCGGAGTGCGGCTGCTGGACCAGGCCGTCGAGTGGCCGCGCGCCGAGCGCCCCCGG
CGGGCGGGCGTGTCCGCCTTCGGTTTCTCGGGAACCAACGCACACCTGATCCTGGAAGAG
GCCCCCGAACCAGCACCACCTGCCAACGAATCCGCCGAGCCCGCCGAGCCCGCCGCGCTC
GTCACCCCCTGGGTGCTGTCGGCGCGCAGCGCGGCCGCGCTGCGCCGCCAGGCCCGGCGG
CTGCTCGACGCGGCGACCGACGGCGACCCGCGGGCGGTGGGCTGGTCGCTGGTGACCACG
CGCTCGGTGTTCGAGCACCGGGCGGTCGTCACCGGCCCCGATGGCGCGACGCTGCGGGAG
CGGCTGGCCGCGCTGGCGGCGGGGGAGCCGGCGCCCCACGTGGTGACCGGCGCGCCGGGC
GCGCCGGGCGCGGGGGTGGTCCTCGTGTTCCCGGGGCAGGGCTCCCAGTGGCCCGGGATG
GGCGCCGAACTGCTGGACGCCTCACCGGTGTTCGCCGCCCGGATCGCGGAGTGCGAGGCG
GCGCTCGCCCCGTACGTGGACTGGTCCCTGACGGAGGTGTTGCGGGGCGCCGACGGCGCC
GCCGACCTCGGCCGCGTCGATGTGGTCCAGCCGGTGCTGTGGGCGCTGATGGTCTCCCTG
GCCGCCCTGTGGGCCCACCACGGCGTGCGGCCCGCGGCGGTCGTCGGCCACTCCCAGGGC
GAGATCGCGGCCGCGTGTGTCGCGGGCGCACTCACGCTGGAGGACGGGGCCCGGGTGGTG
GCCCTGCGCTCGCAGGCGCTGCGGGCGCTGGCCGGCCGTGGCGCGATGGCCTCCCTGGGC
GTCGACCCCGACACGGCCGAGCGGCTCGTCGCCGAGGTGGGCGAGAAGGCGGCCGGTGTG
GGGGTGGCGGCGCTGAACAGCCCGTCCTCCACCGTGGTCTCCGGCCCGCCCGACGCCGTG
GCCGCTGTCGTCGCCGCCTGCGAGGCGACCGGTGCGCGGGCCCGCACCATCGATGTGGAC
TACGCCTCGCACGGTCCCCAGGTGGACGAGATCGCCGACGAGGTGACGGCCCGTCTCGCC
GGAGTCGGCGGTCAGGCCACGGATGTGGCGTTCTACTCGACCGTGACCGGCGGCCCGATG
GACACCGCCACCGCCCTGGACGCAGGCTACTGGCTGACGAACCTGCGCAGGCCCGTCCGT
CTCACCGAGGCGGTCGACGCGCTACTGACCGCGGGGCACCGGGTGTTCATCGAGGTCAGC
ACCCACCCCGTGGTCGTCCCCGCGCTCCAGCAGTGCTTCGAGTCCGCCCAGGTCGCCGCG
GTGGCCATGGGCACGCTGCGCCGCGACGAGGGCGGCCCCGCACAGCTGGCCACCGCGCTG
GCGCAGGCGTTCACCTCCGGGGTGCCGGTGGACTGGCGGCCCTGGTTCGACGGCCCGCCC
GCCCCCCGGACGACGGCCCTGCCCACGTACGCGTTCGACCGCGAGCGCTACTGGCTGCCC
CCGGCCCGTGCGGTCCGCGGCGACGGCGCGCAGGACCCGGCCGAGGCCGAACTGTGGGGC
GCCATCGAGGACCTCGACACCGAGGCGCTGGCGCGGGTGCTGGAGCCGGACGGCACGGCC
GAGGACATCGAGGCGCTGCGGCCCGCCCTGCCCGTACTGTCCACCTGGCGCCGCCGCCAC
CGCGAACGCACCACCCTGGAGTCATGGCGCCACCAGATCAGGTGGACACCGCTGCCCGAC
CCCGCCCCGCCCGCCGTGAGCAGCACCTGGCTGCTGCTCGTCCCCACCGGCTACGAAGAC
CACCCGGCGGTCCGTACCGTGACCGGGGCCCTGACCGGGCACGGCGCCGAGGTCCGGCCC
TGCCCCGCCGACCCCTCCGTCACCAGCCGCGCCGAACTCGCCGAACGGCTGACGGGCTTG
CGCGGTGACGACGCCCCGGCCGGGGTGGTCAGCCTGCTCGCGCTCGACGAGCGCCCCCGC
GCCGACCACCCGGCCGTGCCCGCCGGGCTCGCCGCCACCGTGGCGGCCCTCCAGGCGCTC
GGCGACGCGGGGATCACCGCGCCGCTGTGGTGTGTGACCCAGGGCGCGGTGTCCACCGGC
CACGACGACCCGCTGTCGCACCCCCTCCAGGCCCAGACCTGGGGTTTGGGCCGGGTGGCC
GCGCTGGAACACCCCGACCGGTGGGGGGGTCTGGTGGATCTGCCGGCCGAGCCCGACGAG
CGGACCGAGGCACAGCTGGCGGCCCTGCTGGCCGGCGCGCCGACGGGCGGCCAGGCCGAG
GACCAAGTGGCGATCCGGGCCGGTGGCGGGGCGCTGGCCCGCCGCCTCGTCCACACCACG
AGCGCGCGTACCGCGGACCAGGCGTGGCAGCCCCGGGGCAGCGTGCTGATCACCGGCGGC
ACCGGAGGCGTCGGAGCGCTGCTGGCCCGCTGGGCCGCCGAACGCGGGGCCGCCCAACTG
GTCCTGACCAGCCGCCGTGGCCCCAACGCTCCCGGCGCCGCGGAACTGGCCGCCGAACTG
CGCGGCCTGGGCGTCGCGGTGACCATCGCCGCCTGCGACGCGGCGGACCCGGAGGCCATG
CGCGGCGTGCTGGACGCGATCCCCGCCGAGCACCCGCTGTCCGCCGTCATCCACGCCGCG
GGCGTCAGCGAGCAGGACCTCATCGCCGACGTGGACGACGAGCACCTGAACCGCATGCTG
GCACCGAAGGCGCTCGCGGCCTGGCACCTCCACGAGCTGACCCGGCACCTCGACCTCTCC
GCGTTCATCCTGTTCTCCTCGGTCTCCGCGTCCTGGGGCAGCGGGCAGCAGGCCGGCTAC
GCCGCCGCCAACGCCTACCTGGACGCCCTCGCCGAGCACCGCCGCGGCCTCGGCCTGCCG
ACCACCTCCGTGGCCTGGGGGCTGTGGGGCGAAGTGGGCATGGCCACCACGGCCGACGAG
GTCGACGCCTTCCGCCGCCGCGGCATCCACCCCCTCGACCCCGGCCTGGCCATCGCCTCC
CTTCAGCAGGCGGTGGAACGCCGGGAGACCAACGCCGTGGTCGCCGCCATCGACTGGCGG
CGTTTCCTGACGGGCTTCACCGCGCTGCGCCCGAGCCCGCTGCTCTCCGACCTTCCGGAG
GCCGCCGAGGCGCGCGCCGAGGAGACCCGGCCCAGGGAGGACGAGGCGGACCCGCTGAGG
CGGAAGCTCGCCGGCTGCCCGCCGGCCGAGCAGCACCACATCCTCGTACGACACGTCCAG
GCGCACGCGGCCACCACGCTCGGTCACGCCGACGCGGACGCCGTGCCCCCCACCAAGCCG
TTCCAGGAGCTGGGCTTCGACTCGCTCACCGCCGTCCAACTGCGGGACCGGCTGAACGCC
GGCACCGGGCTGCGGCTGCCCACCACCGTCCTGTTCGACTACCCCTCGGCCGAGGAGCTC
GCCCGCCATCTGCACGGGCTGCTCGTCGCCGACGCGGCCTCGGGCGAACAGCTGATCATG
TCGGAACTGGACGGCTGGGACGCCGCCCACGCCCCGGACACCGTCGACGAGGCCGCCTGC
TCCCGGATCGCCGCACGGCTGCGGCTCCTGGCCGACAAGTGGAGCGACACCGCCCGCGCC
ACCGGGTCCCACAGCGACCTGGAAACGGCGACGGCGGAGGACATATTCGATTTGATCGCC
ACCGAGTTCGGGAAGTCCTGA
[10] KS35..411
[10] AT567..889
[10] methylmalonyl-CoA761..765
[10] KR1213..1392
[10] ACP1495..1565
[10] KS103..1233
[10] AT1699..2667
[10] methylmalonyl-CoA2281..2295
[10] KR3637..4176
[10] ACP4483..4695

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [561-690]  3.70000000000004e-71 G3DSA:3.40.366.10 [761-879]  3.70000000000004e-71 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR006162 Phosphopantetheine attachment site (PTM)
 [1523-1538]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1487-1582]  4.90001027782405e-21 SSF47336
SSF47336   ACP_like
 [1495-1567]  2.4e-19 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1499-1564]  2.80000000000001e-12 PF00550
PF00550   PP-binding
 [1495-1565]  PS50075
PS50075   ACP_DOMAIN
IPR013968 Polyketide synthase, KR (Domain)
 [1213-1391]  6.90000000000001e-64 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [35-285]  2.20000000000002e-86 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [293-411]  3.2e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [567-889]  2.20000000000002e-98 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [4-28]  1.3e-10 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [565-871]  6.70002630158883e-63 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [692-760]  4.00000300869883e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-297]  1.69999999999998e-83 G3DSA:3.40.47.10 [298-464]  3.30000000000002e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [27-463]  5.20000089003336e-98 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1215-1398]  2.4e-39 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [569-870]  2.50000909916183e-115 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1496-1568]  1.20000117458134e-31 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [37-463]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1213-1392]  1.79999754022375e-55 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit