close all open/close all

CDS information : Nanch_00210


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction77,864 / 76,992 / - [in whole cluster]
77,864 / 76,992 / - [in contig]
Locationcomplement(76992..77864) [in whole cluster]
complement(76992..77864) [in contig]
TypeCDS
Length873 bp (290 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productthioesterase
Product (GenBank)NanE
Gene
Gene (GenBank)nanE
EC number
Keyword
  • unusual type
Note
Note (GenBank)
  • putative epoxide hydrolase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
[16984884] Identification of NanE as the thioesterase for polyether chain release in nanchangmycin biosynthesis. (Chem Biol. , 2006)
[18482697] Mechanism of thioesterase-catalyzed chain release in the biosynthesis of the polyether antibiotic nanchangmycin. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>thioesterase [NanE]
MSVPVDHAVHLNVRHRPGRDGRPFLLLHGLGSNARLWDEVADLLAAAGHPVYALDMRGHG
DSDLPEHGYDNATAVADLVAVCRELRLTGALFAGHSWGGNLAVRLAAQHPELAAGLALVD
GGWIGFVDTSRYAPTREKSVELAGWWRDVTGIKEETMRELLRGLHPTWSQTAVEASLADM
VEGPDGLLVQRLPLEHYMSLADSMWQDPPARWYPGITAPVLLLVALPAHAQSWGTYARKW
VAEAEAAIPQAESRWYVDTDHNLHVEEPERVASDLLDLARLVDKPAPERS
selected fasta
>thioesterase [NanE]
TTGTCCGTTCCGGTAGACCACGCAGTGCATTTGAACGTGCGGCACCGGCCGGGCCGCGAC
GGCCGGCCGTTCCTGCTGCTCCACGGGCTGGGGTCCAACGCCCGGCTGTGGGACGAGGTC
GCCGATCTGCTCGCGGCCGCCGGCCACCCCGTCTACGCGCTCGACATGCGCGGACACGGT
GACTCCGACCTGCCGGAGCACGGGTACGACAACGCGACCGCCGTGGCGGACCTGGTGGCC
GTCTGCCGCGAGCTGCGGCTGACCGGGGCGCTGTTCGCCGGCCACTCCTGGGGCGGAAAC
CTCGCGGTGCGGCTCGCGGCCCAGCACCCCGAGCTGGCCGCCGGCCTCGCGCTGGTGGAC
GGCGGCTGGATCGGCTTCGTCGACACCTCTCGTTACGCCCCCACCCGGGAGAAGAGCGTG
GAGCTCGCCGGATGGTGGCGCGACGTCACCGGAATCAAGGAGGAGACCATGCGGGAACTC
CTGCGGGGTCTCCACCCGACGTGGTCACAGACCGCCGTCGAGGCGAGCCTCGCCGACATG
GTGGAAGGGCCGGACGGGCTGCTCGTGCAGCGGCTGCCGCTGGAGCACTACATGTCGCTC
GCGGACAGCATGTGGCAGGACCCGCCCGCCCGCTGGTACCCCGGCATCACGGCGCCCGTT
CTGCTGCTCGTCGCCCTGCCCGCCCACGCCCAGTCCTGGGGCACCTACGCCCGGAAGTGG
GTGGCGGAGGCCGAGGCGGCCATCCCGCAGGCGGAATCCCGCTGGTACGTCGACACCGAC
CACAACCTCCACGTGGAAGAACCCGAGCGGGTGGCGAGCGACCTGCTCGACCTGGCGCGC
CTCGTGGACAAGCCGGCGCCGGAACGGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [48-63]  3.00000067992871e-06 PR00111 [92-105]  3.00000067992871e-06 PR00111 [106-119]  3.00000067992871e-06 PR00111
PR00111   ABHYDROLASE
IPR000639 Epoxide hydrolase-like (Family)
 [48-63]  3.00000067992871e-05 PR00412 [92-105]  3.00000067992871e-05 PR00412 [256-278]  3.00000067992871e-05 PR00412
PR00412   EPOXHYDRLASE
SignalP
 [1-34]  0.098 Signal
Eukaryota   
TMHMM No significant hit