close all open/close all

CDS information : Nanch_00220


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction78,263 / 77,949 / - [in whole cluster]
78,263 / 77,949 / - [in contig]
Locationcomplement(77949..78263) [in whole cluster]
complement(77949..78263) [in contig]
TypeCDS
Length315 bp (104 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NanA10
Gene
Gene (GenBank)nanA10
EC number
Keyword
  • modification base
Note
  • It is proposed that this module is not involved in the extension of polyketide chain, but provides a base for modification.
Note (GenBank)
  • ACP
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)

close this sectionPKS/NRPS Module

13
ACP22..96

close this sectionSequence

selected fasta
>polyketide synthase [NanA10]
MEPNEEATHDEQLVARLASATPEERQRLLAAQVLRRASEVLDVPALDEESNFLENGLSSL
SAVQLAKSLMSDTGLEVPLVAIVEHPTSTLLGKYLAETYEADAA
selected fasta
>polyketide synthase [NanA10]
ATGGAACCCAACGAGGAAGCCACTCACGACGAGCAGCTGGTCGCACGTCTCGCGTCCGCG
ACGCCGGAGGAACGCCAGCGGCTGCTGGCCGCGCAGGTGCTCCGCCGCGCCTCCGAGGTC
CTCGACGTCCCCGCCCTGGACGAGGAGAGCAACTTCCTGGAGAACGGCCTGAGCTCGCTG
AGCGCCGTGCAACTGGCCAAGAGCCTGATGAGCGACACCGGGCTCGAAGTCCCCCTCGTC
GCGATCGTCGAACACCCCACCTCCACCCTGCTCGGCAAGTACCTCGCGGAGACCTACGAA
GCGGATGCGGCCTAG
[13] ACP22..96
[13] ACP64..288

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [22-96]  15.462 PS50075
PS50075   ACP_DOMAIN
 [18-100]  1.9e-13 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [22-97]  2.3e-12 SSF47336
SSF47336   ACP-like
 [32-87]  1.3e-07 PF00550
PF00550   PP-binding
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [30-99]  7.6e-06 SM00823
SM00823   Phosphopantetheine attachment site
SignalP No significant hit
TMHMM No significant hit