close all open/close all

CDS information : Nanch_00230


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction79,763 / 78,327 / - [in whole cluster]
79,763 / 78,327 / - [in contig]
Locationcomplement(78327..79763) [in whole cluster]
complement(78327..79763) [in contig]
TypeCDS
Length1,437 bp (478 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative epoxidase
Product (GenBank)NanO
Gene
Gene (GenBank)nanO
EC number
Keyword
Note
Note (GenBank)
  • putative epoxidase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q846W9
NITE
Monen_00220
PmId
[12940979] Analysis of the biosynthetic gene cluster for the polyether antibiotic monensin in Streptomyces cinnamonensis and evidence for the role of monB and monC genes in oxidative cyclization. (Mol Microbiol. , 2003)

close this sectionSequence

selected fasta
>putative epoxidase [NanO]
MTTPTRAVVLGGGWAGMLTAHVLARHLESVTVVERDILPDGPHHRKGQPQARHVHVLWSS
GAGIVENLLPGTAERLLAAGARRIGFQSDLVTLTAWGWQYRFPATAYAMMCTRPLLDWVV
RDAILAGGRIEVEHGTEAVELAGDRSRVTGVRVRDAGGGEPRLLEADLVVDATGRASRLG
HWLAALGLPAVEQDVVDAGIGYATRMFKAPEGADGNFPAVQVAADPLTRQPGRFGVVYPQ
EGGRWLVTLTSTRGAPLPTDEDEFTGYAKVLRHSIVSELMSVAEPISPIFQSHSGANRRM
YPERMPQWPEGLLILGDSLAAFNPVYGHGMSSAARAAEALDKELARDGFGEGGTRQVQRA
LSEVVDDPWIMAGLNDIQYVNCRNLSSDPRLTGPDVAERLKFSDFLSGKSIRSPKVCEVT
TSVLSLNAPQKALGDSRFLSLLRTDTSHPKLVEPPFHPEELEMVGLKPSGIAAKGALG
selected fasta
>putative epoxidase [NanO]
ATGACCACACCGACACGTGCCGTTGTGCTGGGCGGCGGATGGGCCGGCATGCTCACCGCC
CATGTGCTGGCCCGCCACCTGGAATCCGTGACCGTGGTGGAGCGTGACATCCTGCCCGAC
GGACCGCACCACCGTAAGGGACAGCCCCAGGCCCGCCACGTCCACGTCCTGTGGTCCAGT
GGCGCGGGCATCGTCGAGAACCTGCTGCCGGGCACCGCCGAACGGCTGCTGGCGGCCGGT
GCCCGCCGGATCGGCTTCCAGAGCGACCTGGTGACCCTGACGGCGTGGGGCTGGCAGTAC
CGCTTCCCGGCCACCGCGTACGCGATGATGTGCACCCGCCCCCTGCTCGACTGGGTGGTG
CGTGACGCGATCCTCGCCGGCGGCCGGATCGAGGTGGAGCACGGCACCGAGGCCGTCGAG
CTGGCCGGGGACCGCTCCAGGGTCACCGGGGTGCGGGTGCGGGACGCGGGCGGCGGCGAA
CCCAGGCTGCTGGAGGCCGACCTGGTGGTGGACGCCACGGGGCGCGCCTCGCGCCTGGGC
CACTGGCTGGCGGCCCTCGGCCTGCCGGCCGTCGAGCAGGACGTGGTCGACGCCGGCATC
GGCTACGCGACCCGCATGTTCAAGGCGCCCGAGGGCGCGGACGGAAACTTCCCCGCGGTC
CAGGTCGCCGCCGACCCCCTCACCCGGCAACCGGGCCGCTTCGGCGTGGTCTACCCGCAG
GAGGGCGGTCGCTGGCTGGTCACCCTGACCAGCACGCGCGGCGCCCCGCTGCCCACCGAC
GAGGACGAGTTCACCGGCTACGCCAAGGTCCTGCGGCACTCGATCGTCAGCGAACTCATG
AGCGTCGCCGAGCCCATCAGCCCCATCTTCCAGTCGCACTCGGGAGCCAACCGGCGCATG
TACCCCGAGCGCATGCCGCAGTGGCCGGAGGGCCTGCTGATCCTCGGCGACTCGCTGGCG
GCGTTCAATCCGGTCTACGGCCACGGCATGAGCTCGGCGGCCCGTGCCGCCGAGGCCCTG
GACAAGGAGCTGGCACGCGACGGCTTCGGCGAGGGCGGCACCCGGCAGGTCCAGCGCGCG
CTGAGCGAGGTGGTGGACGATCCCTGGATCATGGCCGGGCTGAACGACATCCAGTACGTC
AACTGCCGCAACCTCTCCAGCGACCCGCGGCTGACCGGCCCGGACGTCGCGGAGCGGCTG
AAGTTCTCCGACTTCCTCTCCGGCAAGTCGATCCGCTCGCCGAAGGTGTGCGAGGTCACC
ACCAGCGTGCTGAGCCTGAACGCGCCGCAGAAGGCCCTGGGCGACTCCCGCTTCCTGTCG
TTGCTGCGCACCGACACCAGCCACCCGAAGCTCGTCGAACCGCCGTTCCACCCCGAGGAG
CTGGAGATGGTCGGGCTCAAGCCGTCCGGCATCGCCGCGAAGGGCGCGCTCGGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002938 Monooxygenase, FAD-binding (Domain)
 [6-352]  4.4e-08 PF01494
PF01494   FAD_binding_3
SignalP
 [1-24]  0.972 Signal
Eukaryota   
 [1-24]  0.277 Signal
Bacteria, Gram-positive   
 [1-20]  0.793 Signal
Bacteria, Gram-negative   
TMHMM No significant hit