close all open/close all

CDS information : Nanch_00250


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction83,192 / 80,784 / - [in whole cluster]
83,192 / 80,784 / - [in contig]
Locationcomplement(80784..83192) [in whole cluster]
complement(80784..83192) [in contig]
TypeCDS
Length2,409 bp (802 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)NanA9
Gene
Gene (GenBank)nanA9
EC number
Keyword
  • modification base
Note
  • It is proposed that this module is not involved in the extension of polyketide chain, but provides a base for modification.
Note (GenBank)
  • PKS
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)

close this sectionPKS/NRPS Module

13
KS43..418
AT589..688

close this sectionSequence

selected fasta
>polyketide synthase [NanA9]
MPSLRRNVMTVADAKVVEALRTSLLETERLRKENDRLRAAPREPVAITGMACRYPGGVES
PDDLWTLLTEERDAIGAFPADRGWDLDGLYGPDAHPDVRSAVEEGGFLSDAGAFDPAPFG
ISPGEASVMDPQQRLLLETTWEAFERAGIDPRSVRGRRCGVFMGTTGQDYTPHLKDVPDE
LLGHIASGGSSAVLSGRLASVFGLEGPTATLDTACSGSLVALHLACQSLRGGECSMALAG
GVTVMSSPETFIGTGRGIGLPAAARCRSFADGAEGIAFAEGAGVVLLERLSTARAHGRPV
LAVVRGSAIGQEGTNNGVSASNGPAQQRLIRQALAAAGLLPHEIDAVEGQGTGGLLSDAV
EAQALASVYGEGRPADRPLLLGAVKSNLGHTQGASGVAGVIKTVQAMRHGVLPRTLHTEV
PSPHISWKRGRIRLLTAATPWPGTDRPLRSGVSAFGFGGTNAHVIVEQAPPEDDPPPPLP
EAEGEPGSAGVALWPLSGCDPDALRDQAARLLAHLDERPGLRPADVGLSLGTSRAALEHR
GVVVGESRQELLDGLRALAEGRAAPHVARGAIGRRPRLVVLFTGHAPAPGTGKQLYDAFP
AFADAFDTVCAALDAHLGFPARDAMLTGADPTSAAVPDPARAFAIQVALFRLVESWGTRP
GAVRGHGIGRLAEDHVSGRLALPDACAALTGPHEAPDPPRDFAQRVRDLAGDGTVYLELG
GHEVAGLLDGAGAHAVAALRPGVAEATSAATGLARAHARGTAVDWRAVFGPEARRVELPT
YAFRRGRYWRAAFDMSLVRPDR
selected fasta
>polyketide synthase [NanA9]
GTGCCGTCCCTTCGGAGGAATGTCATGACAGTGGCCGACGCCAAGGTCGTCGAGGCCCTG
CGCACCTCGCTCCTGGAGACAGAGCGGCTGCGCAAGGAGAACGACCGGCTGCGCGCGGCA
CCCCGGGAGCCCGTCGCGATCACCGGGATGGCCTGCCGCTATCCCGGGGGTGTCGAGTCG
CCGGACGACCTGTGGACACTGCTGACCGAGGAGCGGGACGCCATCGGCGCCTTTCCCGCC
GACCGGGGCTGGGACCTGGACGGCCTGTACGGGCCGGACGCCCACCCGGACGTGCGCAGC
GCGGTCGAGGAGGGAGGTTTCCTCAGCGACGCCGGCGCGTTCGACCCCGCGCCGTTCGGG
ATCTCCCCGGGCGAGGCCTCGGTGATGGACCCTCAGCAGCGGCTGCTGCTGGAGACCACC
TGGGAGGCGTTCGAGCGGGCCGGGATCGACCCGCGGTCGGTCCGCGGCCGGCGCTGTGGC
GTCTTCATGGGCACCACCGGCCAGGATTACACGCCGCACCTGAAGGACGTCCCCGACGAG
CTGCTCGGCCACATCGCCTCCGGCGGTTCGAGCGCCGTGCTGTCCGGCCGCCTCGCCTCC
GTCTTCGGCCTCGAAGGGCCCACGGCCACCCTCGACACCGCCTGCTCCGGATCCCTGGTG
GCGCTGCACCTGGCCTGCCAGTCGCTGCGCGGCGGCGAGTGTTCCATGGCTCTGGCCGGC
GGCGTCACCGTGATGTCCAGCCCGGAGACGTTCATCGGGACCGGCCGGGGGATAGGGCTG
CCCGCCGCTGCCCGCTGCCGCTCGTTCGCCGACGGGGCCGAGGGGATCGCCTTCGCCGAG
GGGGCGGGCGTGGTGCTCCTGGAGCGTCTCTCCACCGCCCGCGCGCACGGGCGTCCCGTG
CTCGCCGTGGTCCGTGGCAGCGCGATCGGCCAGGAAGGCACCAACAACGGCGTGAGCGCG
TCGAACGGCCCCGCCCAGCAGCGGCTGATCAGGCAGGCGCTGGCCGCCGCGGGGCTCCTG
CCGCACGAGATCGACGCGGTCGAGGGCCAGGGCACCGGTGGCCTGCTCAGTGACGCGGTG
GAGGCCCAGGCGCTGGCGTCCGTCTACGGCGAGGGCCGCCCGGCCGACCGCCCGCTGCTG
CTGGGGGCGGTGAAGTCCAACCTCGGCCACACGCAGGGGGCCAGCGGTGTGGCCGGGGTG
ATCAAGACGGTCCAGGCCATGCGCCACGGCGTCCTGCCGCGCACCCTGCACACCGAGGTG
CCGTCGCCGCACATCTCCTGGAAGCGGGGTCGGATCCGGCTGCTCACCGCTGCCACCCCC
TGGCCGGGAACTGACCGGCCACTTCGGTCCGGGGTGTCCGCGTTCGGATTCGGCGGCACC
AATGCGCATGTGATTGTTGAACAGGCGCCGCCCGAAGACGACCCTCCGCCCCCGCTACCC
GAAGCGGAAGGAGAGCCGGGAAGCGCCGGGGTGGCGCTCTGGCCGCTCTCCGGCTGCGAC
CCCGACGCGCTGCGCGACCAGGCGGCCCGTCTGCTGGCCCACCTCGACGAGCGGCCCGGG
CTCCGGCCGGCCGACGTCGGCCTGTCGCTGGGGACGTCCCGGGCCGCGCTGGAACACCGC
GGCGTGGTCGTCGGCGAGAGCCGCCAGGAGCTGCTGGACGGACTGCGCGCACTGGCCGAG
GGAAGGGCTGCGCCCCATGTCGCCCGGGGCGCGATCGGACGCCGGCCCCGGCTCGTCGTC
CTGTTCACGGGCCACGCCCCCGCACCCGGCACCGGCAAGCAGCTGTATGACGCCTTCCCG
GCGTTCGCCGACGCGTTCGACACGGTCTGCGCGGCGCTCGACGCCCACCTCGGCTTCCCC
GCCCGTGACGCGATGCTCACCGGCGCGGACCCCACCTCGGCGGCCGTCCCCGACCCGGCC
AGGGCCTTCGCGATCCAGGTGGCGCTGTTCCGACTGGTCGAGTCGTGGGGGACGAGGCCC
GGTGCGGTGCGCGGCCACGGCATCGGCCGCCTCGCCGAAGACCACGTCAGCGGGCGACTG
GCACTGCCCGACGCGTGCGCGGCGCTGACCGGCCCGCACGAGGCCCCGGACCCGCCGCGG
GACTTCGCCCAGCGGGTCCGTGACCTGGCCGGGGACGGCACGGTCTACCTGGAACTGGGC
GGCCACGAGGTGGCCGGACTCCTCGACGGCGCGGGGGCGCACGCGGTGGCCGCGCTGCGG
CCCGGCGTCGCGGAGGCCACCTCCGCCGCCACCGGCCTCGCCCGGGCGCATGCCCGCGGC
ACCGCCGTGGACTGGCGGGCGGTCTTCGGGCCCGAGGCCCGCCGCGTCGAGCTGCCCACC
TACGCCTTCCGGCGCGGACGGTACTGGCGCGCCGCGTTCGACATGAGCCTGGTACGGCCC
GACCGGTAA
[13] KS43..418
[13] AT589..688
[13] KS127..1254
[13] AT1765..2064

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [573-688]  1.6e-18 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [43-293]  6.7999999999999e-83 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [301-418]  2.1e-38 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [589-688]  2.1e-09 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [577-689]  3.29999802154459e-13 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016038 Thiolase-like, subgroup (Domain)
 [43-304]  3.49999999999995e-81 G3DSA:3.40.47.10 [305-472]  4.70000000000003e-54 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [35-471]  1.59998835313644e-86 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-19]  0.202 Signal
Eukaryota   
TMHMM No significant hit