close all open/close all

CDS information : Nanch_00280


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction101,467 / 100,196 / - [in whole cluster]
101,467 / 100,196 / - [in contig]
Locationcomplement(100196..101467) [in whole cluster]
complement(100196..101467) [in contig]
TypeCDS
Length1,272 bp (423 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)NanP
Gene
Gene (GenBank)nanP
EC number
Keyword
  • C-30 hydroxylate
Note
Note (GenBank)
  • putative cytochrome P450
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q846W4
NITE
Monen_00270
PmId
[8017935] Production of 26-deoxymonensins A and B by Streptomyces cinnamonensis in the presence of Metyrapone. (Appl Environ Microbiol. , 1994)

close this sectionSequence

selected fasta
>putative cytochrome P450 [NanP]
MNRGVVSPTEATPASSAKATRPPDFMDPSFWLRPRDERAEVFEKLRALPGPEFVPPRLPW
GPLASGYYALSKHADICEVSRRPQDFSSEGATAILPPEMDEFYGSMINMDNPEHSRLRRI
VARSFGRGMAPKFDAMSRRVARRIVDELIERGPGDFIRPAAEMPIAVLSTMMGIPGEDYE
FLFERTNTIMGGADPELAADPEKMAAAVLGALRDLGDYIGRLREDRLARPGPDVITKLVQ
VQEDGEQLTNQELVSFFILLINAGMETTRNVIAQALVLLTEHPDQRQLLLSDFELHAKGA
VEEILRVGTPINWMRRTATGDCEMNGHRFRKGDEIFLFYWSANHDEKVFEDAYRFDITRD
PNPHLSFGAVGPHFCLGAHLARIEIIAMLRELLASLPDIRVEGEPVRLASSFIEGFKELS
CTF
selected fasta
>putative cytochrome P450 [NanP]
TTGAATCGAGGCGTTGTGTCTCCTACGGAAGCCACCCCCGCATCGTCCGCCAAAGCCACC
AGGCCTCCCGACTTCATGGATCCGTCCTTCTGGCTGCGGCCGCGTGATGAGCGGGCCGAG
GTGTTCGAGAAGCTGCGCGCGCTGCCGGGCCCGGAATTCGTTCCGCCGCGGCTGCCCTGG
GGGCCGTTGGCATCCGGTTATTACGCGCTGTCGAAACACGCCGACATCTGCGAGGTGAGC
CGCCGCCCTCAGGACTTCTCCTCGGAGGGCGCCACGGCGATCCTGCCGCCGGAGATGGAC
GAGTTCTATGGCTCCATGATCAACATGGACAATCCGGAGCACTCCAGATTACGGCGCATC
GTCGCGCGGTCGTTCGGCCGAGGAATGGCGCCCAAGTTCGACGCCATGTCCCGGCGGGTG
GCCCGGCGGATCGTGGACGAGCTCATCGAGCGCGGCCCCGGCGACTTCATCCGCCCGGCG
GCGGAGATGCCGATCGCCGTCCTCAGCACCATGATGGGAATTCCGGGGGAAGACTACGAA
TTCCTCTTCGAGCGGACGAACACGATCATGGGAGGGGCTGATCCCGAACTCGCGGCCGAC
CCGGAGAAGATGGCGGCGGCGGTGCTGGGAGCCCTGCGAGACCTCGGAGACTACATCGGA
CGGCTCCGCGAGGACCGGCTCGCCCGTCCCGGCCCCGATGTGATCACCAAGCTGGTCCAG
GTGCAGGAAGACGGAGAGCAACTGACCAACCAGGAACTGGTCTCGTTCTTCATCCTCCTC
ATCAACGCGGGCATGGAGACGACCCGCAACGTCATCGCCCAGGCCCTGGTTCTGCTGACC
GAACATCCTGATCAGCGGCAACTCCTGCTGTCGGACTTCGAACTCCACGCGAAGGGCGCC
GTCGAGGAGATCCTCCGGGTGGGCACGCCCATCAACTGGATGCGCCGGACCGCGACCGGC
GACTGCGAGATGAACGGCCATCGGTTCCGCAAGGGCGACGAGATCTTCCTCTTCTACTGG
TCCGCCAACCACGACGAGAAGGTCTTCGAGGATGCGTACCGGTTCGACATCACACGGGAC
CCCAACCCGCATCTGTCGTTCGGCGCGGTGGGGCCGCACTTCTGCCTCGGTGCTCATCTC
GCCCGGATCGAGATCATCGCCATGCTCCGGGAACTCCTCGCCTCACTGCCGGACATCCGC
GTGGAGGGCGAGCCGGTCCGGCTGGCATCGAGCTTCATTGAGGGCTTCAAAGAGTTGAGC
TGCACCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [44-423]  9.20006495413779e-81 SSF48264
SSF48264   Cytochrome_P450
 [39-423]  4.69999999999992e-92 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [231-285]  1.3e-05 PF00067 [300-393]  6.70000000000001e-15 PF00067
PF00067   p450
IPR002397 Cytochrome P450, B-class (Family)
 [109-120]  3.70001063537244e-33 PR00359 [171-186]  3.70001063537244e-33 PR00359 [217-239]  3.70001063537244e-33 PR00359 [299-310]  3.70001063537244e-33 PR00359 [316-343]  3.70001063537244e-33 PR00359 [344-359]  3.70001063537244e-33 PR00359 [375-386]  3.70001063537244e-33 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit