close all open/close all

CDS information : Nanch_00290


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction101,593 / 102,600 / + [in whole cluster]
101,593 / 102,600 / + [in contig]
Location101593..102600 [in whole cluster]
101593..102600 [in contig]
TypeCDS
Length1,008 bp (335 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LacI family transcriptional regulator
Product (GenBank)NanR3
Gene
Gene (GenBank)nanR3
EC number
Keyword
Note
Note (GenBank)
  • putative LacI family transcription regulator
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
P37947
PmId
[8407808] The degA gene product accelerates degradation of Bacillus subtilis phosphoribosylpyrophosphate amidotransferase in Escherichia coli. (J Bacteriol. , 1993)

close this sectionSequence

selected fasta
>putative LacI family transcriptional regulator [NanR3]
MTIRDVAKASGVSPSTVSRALAPGGAVSPVTRERVRAAADRLGYQPNQAARGLITGRTGH
LGVIVPDLLNPFFADICKGVQARARGLGLTVFVSDTERDEGLELDAIRTLAPQVDGIVLC
SPHLSGEELGSLGDFTDKPIVLLHRKEPGFGSVTADLVEGMTDALTHLHALGHRRIAYVG
GPRSSWAARERAAGVEAVAASGLVEIVQVGSVAPHFDGGVTGAADVVLASGASAVLAFDD
IVAFGLISRFTVRGVRVPEEMSVVGCDDIALSGMAAPPLTTVSVPKAHGARAAVDLLCRI
LATPAAEGEQPPQRVLPTHLVVRGSTAALDRRQRA
selected fasta
>putative LacI family transcriptional regulator [NanR3]
GTGACGATTCGGGACGTCGCGAAGGCGTCGGGGGTGTCCCCGTCCACCGTGTCGCGGGCC
CTGGCGCCCGGCGGGGCGGTGAGCCCCGTGACGCGCGAGCGGGTACGGGCCGCCGCCGAC
CGGCTCGGCTACCAGCCCAACCAGGCGGCGCGCGGGCTGATCACCGGGCGTACGGGCCAT
CTGGGCGTGATCGTCCCGGATCTGCTGAATCCCTTCTTCGCGGACATCTGCAAGGGGGTG
CAGGCGCGGGCCCGGGGGCTTGGCCTCACGGTGTTCGTGAGCGACACCGAGCGGGACGAG
GGCCTGGAGCTGGACGCCATCCGCACACTGGCCCCGCAGGTGGACGGGATCGTGCTGTGT
TCACCGCATCTGAGCGGCGAGGAGCTGGGGTCGCTCGGGGACTTCACCGACAAGCCGATC
GTGCTGCTGCACCGCAAGGAGCCCGGGTTCGGAAGCGTCACGGCCGATCTGGTGGAGGGG
ATGACCGACGCACTGACCCATCTGCACGCGCTGGGCCACCGCAGGATCGCGTATGTCGGC
GGGCCGCGCAGCTCGTGGGCGGCGCGGGAGCGGGCGGCCGGTGTCGAAGCGGTGGCCGCG
TCGGGGTTGGTGGAGATCGTCCAGGTGGGGAGCGTGGCGCCGCATTTCGACGGCGGGGTG
ACCGGGGCCGCCGATGTGGTGCTGGCCAGCGGGGCGAGTGCGGTGCTCGCGTTCGACGAC
ATCGTCGCGTTCGGGCTGATCAGCCGGTTCACGGTGCGCGGGGTGCGGGTGCCGGAGGAG
ATGAGCGTGGTGGGGTGTGACGATATCGCCCTGTCGGGGATGGCGGCGCCGCCGCTGACC
ACGGTCTCGGTGCCCAAGGCGCATGGCGCGCGGGCCGCCGTCGATCTGCTGTGCCGCATA
CTGGCCACCCCGGCCGCCGAGGGCGAGCAGCCTCCGCAGCGGGTGCTCCCCACCCATCTG
GTGGTACGGGGCTCGACGGCCGCCCTCGACCGGCGGCAGCGGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000843 Transcription regulator HTH, LacI (Domain)
 [1-55]  PS50932
PS50932   HTH_LACI_2
 [1-70]  9.00000407957274e-31 SM00354
SM00354   HTH_LACI
 [2-47]  4.5e-16 PF00356
PF00356   LacI
 [3-21]  PS00356
PS00356   HTH_LACI_1
IPR010982 Lambda repressor-like, DNA-binding domain (Domain)
 [1-52]  5.5e-23 G3DSA:1.10.260.40
G3DSA:1.10.260.40   G3DSA:1.10.260.40
 [1-57]  5.79999653854781e-18 SSF47413
SSF47413   Lambda_like_DNA
SignalP
 [1-22]  0.349 Signal
Bacteria, Gram-positive   
TMHMM No significant hit