close all open/close all

CDS information : Nanch_00300


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction102,600 / 103,541 / + [in whole cluster]
102,600 / 103,541 / + [in contig]
Location102600..103541 [in whole cluster]
102600..103541 [in contig]
TypeCDS
Length942 bp (313 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative AraC family transcriptional regulator
Product (GenBank)NanR4
Gene
Gene (GenBank)nanR4
EC number
Keyword
Note
Note (GenBank)
  • probable araC family transcription regulator
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Family/Domain
FD
IPR018060

close this sectionSequence

selected fasta
>putative AraC family transcriptional regulator [NanR4]
MDPLAGLLDGPRARGAFLLRMVMDPPWSVRIEDRAPLCVMTVARGEAWVVPDRGEARRLG
PGDVAVVRGPDPYTVAGDPATEPQAWILPGEVCRTAGGEDLAERMALGVRTWGNSEHGAT
TMLVGTYRMDGEISRRLLDALPPLLVLGRERCDSPLLPWLGEEIVKEEAGQTAVLDRLLD
LLLISVLRAWFARPEARAPAWYRALGDPVVGRALRLLQNNPGHPWTVALLAAETGISRAV
LARRFTELVGEPPMAYLTGWRLDLAADLLREPDATLGAVARRVGYGSSFALSAAFKRVRG
VSPREHRSAASAG
selected fasta
>putative AraC family transcriptional regulator [NanR4]
ATGGATCCACTCGCCGGTCTCCTGGACGGGCCGAGGGCCCGGGGGGCGTTTCTGCTCCGG
ATGGTGATGGACCCGCCCTGGTCGGTACGGATCGAGGACCGGGCCCCGCTGTGCGTGATG
ACCGTGGCGCGCGGTGAGGCGTGGGTGGTCCCGGACCGGGGCGAAGCGCGGCGCCTTGGC
CCGGGGGATGTGGCGGTCGTGCGCGGCCCCGATCCGTACACCGTGGCCGGCGATCCGGCC
ACCGAGCCCCAGGCGTGGATCCTGCCGGGCGAGGTGTGCCGCACCGCCGGGGGCGAGGAT
CTGGCGGAGCGGATGGCGCTGGGCGTACGCACCTGGGGCAACAGCGAACACGGTGCGACG
ACGATGCTGGTCGGCACGTACCGGATGGACGGGGAGATCAGCCGGCGGCTGCTGGACGCG
CTGCCCCCGCTGCTGGTGCTGGGGCGTGAGCGTTGCGATTCGCCGTTGCTGCCGTGGCTC
GGCGAGGAGATCGTCAAGGAGGAGGCGGGCCAGACGGCCGTGCTGGACCGGCTGCTGGAT
CTGCTGCTGATCTCGGTGCTGCGGGCGTGGTTCGCGCGGCCTGAGGCGCGGGCCCCGGCC
TGGTACCGGGCGCTGGGCGACCCGGTGGTCGGCCGCGCGCTGCGGCTGCTGCAGAACAAC
CCGGGCCATCCGTGGACGGTGGCGCTGCTGGCGGCGGAGACCGGGATCTCCCGTGCGGTG
CTGGCCCGCCGGTTCACCGAGCTGGTCGGCGAGCCGCCGATGGCGTATCTGACCGGCTGG
CGGCTGGATCTGGCCGCCGATCTGCTGCGGGAGCCGGACGCCACCCTCGGGGCGGTGGCC
CGGCGGGTCGGCTACGGCAGCTCCTTCGCGCTGAGCGCCGCCTTCAAGCGGGTGCGCGGG
GTCAGCCCGCGGGAGCACCGCTCCGCGGCCAGCGCAGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [207-260]  9.7e-16 G3DSA:1.10.10.60 [261-309]  6.90000000000001e-13 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [206-257]  4.00000300869883e-10 SSF46689 [260-309]  4.30000170645867e-11 SSF46689
SSF46689   Homeodomain_like
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [211-309]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [224-307]  5.00000909915354e-30 SM00342
SM00342   HTH_ARAC
IPR018062 HTH domain AraC-type, conserved site (Conserved_site)
 [261-303]  PS00041
PS00041   HTH_ARAC_FAMILY_1
SignalP No significant hit
TMHMM No significant hit