close all open/close all

CDS information : Nanch_00310


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction105,025 / 103,451 / - [in whole cluster]
105,025 / 103,451 / - [in contig]
Locationcomplement(103451..105025) [in whole cluster]
complement(103451..105025) [in contig]
TypeCDS
Length1,575 bp (524 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycosyltransferase
Product (GenBank)NanG6
Gene
Gene (GenBank)nanG6
EC number
Keyword
Note
Note (GenBank)
  • putative glycosyltransferase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
Q9RP57
PmId
[10531250] Molecular characterization of the locus encoding biosynthesis of the lipopolysaccharide O antigen of Escherichia coli serotype O113. (Infect Immun. , 1999)
Family/Domain
FD
IPR001296

close this sectionSequence

selected fasta
>putative glycosyltransferase [NanG6]
MLGAAPVSAVSLTGVGADIWALPRVVGTQYRAAMTRTAYIRHVIARDEKVTIRWGMAVQI
GFSARPLAPRRYADRAATPTAYRRASYVIYIPPSVMVGCDSACDIRKMGPGRPMRVLHII
SRLGAGGAEQQLRLLLRHLPARCDVLTLTAPGAAGHGIRADGVPVTHLPMGVRDPMGTAR
LARFIRGGGYDLVHTHLYRACVHGRVAARLAGVGAVVATEHSLGERHIDGRPLTVGTRAR
YLATERLGSATVAVSAAVADRLRGWGVANHRIHLVPNGLDARHFSFTPAARTAARARLGI
PAHAFVVGGVGRLVAAKRFDVALRAVAELPQARLLLVGDGPERTALRDLAAWLGVADRIR
LLGERDGAVAGTGDRPADIPGLLAAMDVLVAPSAEEAFGLAALEALAAGLPGFSRRLPGP
RRTAARRGPRRPPHRARHRRPGRRPARAGRRRPRTAPGARRCRALRHHPHRPPAGPAVRT
LRQLRARRLRSRPRRHPALAAERCSRGLTPRTRLKAALSAKELP
selected fasta
>putative glycosyltransferase [NanG6]
GTGCTGGGCGCGGCTCCCGTCTCGGCCGTGTCTCTGACGGGGGTAGGTGCGGACATCTGG
GCACTCCCGCGGGTCGTCGGGACGCAATATCGCGCGGCGATGACCCGGACGGCCTACATT
CGTCATGTCATCGCGCGAGATGAGAAGGTAACAATCCGCTGGGGAATGGCTGTGCAAATC
GGATTTTCGGCGCGCCCCCTCGCGCCTCGCCGATATGCCGATCGGGCCGCCACTCCGACG
GCCTATCGCCGCGCGTCTTACGTGATTTACATCCCGCCGTCTGTCATGGTCGGATGTGAT
TCAGCGTGCGATATACGGAAGATGGGGCCCGGTCGCCCGATGAGAGTGCTGCACATCATC
TCGCGCCTCGGCGCGGGTGGCGCCGAACAGCAACTGCGGCTGCTGCTGCGCCACCTGCCC
GCCCGTTGTGACGTCCTCACCCTGACCGCGCCCGGGGCCGCCGGCCACGGCATCCGGGCG
GACGGTGTGCCCGTCACCCATCTGCCGATGGGTGTCCGCGACCCGATGGGGACGGCCCGG
CTGGCGCGGTTCATCCGCGGTGGCGGCTACGACCTGGTGCACACCCATCTCTACCGGGCC
TGTGTCCACGGCCGGGTCGCGGCCCGGCTGGCGGGTGTCGGCGCCGTGGTCGCCACCGAG
CACAGCCTGGGTGAGCGCCATATCGACGGCCGCCCGCTCACCGTCGGCACCCGCGCCCGC
TATCTCGCCACCGAACGACTGGGCTCGGCGACCGTCGCCGTGTCGGCCGCCGTCGCCGAC
CGGCTGCGCGGCTGGGGCGTCGCCAACCACCGCATCCACCTGGTGCCCAACGGGCTGGAC
GCCCGCCACTTCAGCTTCACCCCGGCCGCCCGCACCGCCGCCCGGGCCCGTCTCGGCATC
CCCGCACACGCCTTCGTCGTCGGCGGGGTCGGCCGGCTGGTGGCGGCCAAGCGCTTCGAT
GTGGCGCTGCGGGCCGTCGCCGAACTGCCCCAGGCCCGGCTGTTGTTGGTCGGGGACGGA
CCCGAACGCACCGCGCTGCGCGACCTGGCCGCCTGGCTCGGGGTGGCCGACCGGATCCGG
CTGCTCGGCGAGCGCGACGGGGCGGTGGCCGGGACCGGGGACCGCCCCGCGGACATCCCC
GGGCTGCTTGCCGCCATGGATGTGCTCGTCGCGCCGTCCGCGGAGGAGGCGTTCGGGCTC
GCCGCCCTGGAAGCCCTGGCGGCCGGGCTCCCGGGGTTCTCACGGCGTCTGCCCGGCCCT
CGACGAACTGCCGCCCGGCGCGGCCCCCGGCGCCCGCCGCATCGGGCCCGGCACCGCCGC
CCTGGCCGACGCCCTGCGCGAGCGGGCCGCCGCCGGCCCCGTACGGCACCCGGTGCCCGC
CGCTGTCGAGCGCTACGACATCATCCGCACCGCCCGCCGGCTGGCCCTGCTGTACGAACG
CTCCGTCAGCTGCGGGCCCGACGGCTGCGCTCGCGGCCCCGCCGTCACCCTGCGCTGGCC
GCGGAGCGGTGCTCCCGCGGGCTGACCCCGCGCACCCGCTTGAAGGCGGCGCTCAGCGCG
AAGGAGCTGCCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001296 Glycosyl transferase, family 1 (Domain)
 [294-423]  1.6e-16 PF00534
PF00534   Glycos_transf_1
SignalP
 [1-17]  0.942 Signal
Eukaryota   
TMHMM No significant hit