close all open/close all

CDS information : Nanch_00320


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction104,970 / 106,805 / + [in whole cluster]
104,970 / 106,805 / + [in contig]
Location104970..106805 [in whole cluster]
104970..106805 [in contig]
TypeCDS
Length1,836 bp (611 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)NanG7
Gene
Gene (GenBank)nanG7
EC number
Keyword
Note
Note (GenBank)
  • putative glycosyltransferase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)

close this sectionSequence

selected fasta
>hypothetical protein [NanG7]
MSAPTPVRDTAETGAAPSTAPPPARPAHHEMAPCRRGPTESYEYQRYSQLAGPLTQPPSG
RPYRVRCRSLLAQEPHRVRAALLLCAAPVCSALLLLWLLQPQHWVHRDGVTGWETAADRT
MLFSIALIEAFRLFTVVSNAHATLVARDPVPVTAEPGTRVAFLTSFVPGKEPIDMVRATL
EGAMQVRHAGGLDVWLLDEGNDEEAKELCARLGVRHFSRKGIEKWNQPKGSFRARTKHGN
YNAWLDAHGDDYEFMACVDTDHVPLPNFLERMMGYFRDPDVAFVVGPQVYGNYDTAVTKA
AESQQFLFHALIQRAGNAYGGPMFVGTNNAVRIAALRSIGGLYDSITEDMATGFELHRRR
NPVTRKKWRSVYTPDVLAVGEGPSTWTDFFTQQLRWSRGTYETVLKQFWKGPFTLSPGKL
LNYSLMIAYYPMTALNWMLSALSCALFLVLGASGIHIPAEMWMMLYSDAAALQIGLYIWN
RRHNVSPHEPEGSGGVAGMLLSALSAPIYAKSLCDALLRRKSRFVVTPKGDSSSADRLST
FRIHLVWAAVFGGSLVASLFLGHTHAAMRTWAMLALALCLAPMAIWSGGLLLTRRGRRTA
PAVPTARAEAH
selected fasta
>hypothetical protein [NanG7]
ATGTCCGCACCTACCCCCGTCAGAGACACGGCCGAGACGGGAGCCGCGCCCAGCACCGCT
CCCCCTCCCGCGCGGCCCGCGCACCATGAGATGGCCCCCTGCCGCCGGGGCCCGACCGAG
AGTTATGAGTACCAGCGGTACAGCCAGCTGGCGGGCCCGCTGACCCAGCCCCCGTCCGGC
CGCCCGTACCGGGTGCGCTGCCGGAGCCTGCTGGCGCAGGAACCGCACCGCGTCCGCGCG
GCGCTGCTGCTGTGCGCGGCGCCGGTGTGCTCGGCGCTGCTGCTGTTGTGGCTGCTGCAG
CCCCAGCACTGGGTGCACCGCGACGGTGTGACGGGCTGGGAGACGGCCGCGGACCGGACG
ATGCTGTTCTCGATCGCGCTGATCGAGGCGTTCCGCCTGTTCACCGTGGTCTCCAACGCG
CACGCCACGCTGGTGGCCCGCGACCCGGTGCCGGTGACCGCCGAGCCCGGGACCCGGGTG
GCGTTCCTGACCAGCTTCGTCCCCGGCAAGGAGCCGATCGACATGGTCCGGGCGACGCTG
GAGGGGGCGATGCAGGTCAGACACGCCGGGGGGCTCGACGTATGGCTGCTCGACGAGGGA
AACGACGAGGAGGCCAAGGAGCTGTGCGCACGGCTGGGCGTACGGCATTTCTCCCGCAAG
GGCATCGAGAAATGGAATCAGCCCAAGGGCTCCTTCCGCGCCAGGACCAAGCACGGGAAT
TACAACGCCTGGCTGGACGCCCATGGCGACGACTATGAATTCATGGCCTGTGTGGACACC
GATCATGTGCCGCTGCCCAACTTCCTGGAGCGCATGATGGGTTACTTCCGCGACCCCGAT
GTCGCCTTCGTGGTCGGTCCGCAGGTGTACGGAAATTACGATACGGCGGTCACCAAGGCG
GCCGAGAGCCAGCAGTTCCTCTTCCACGCGCTGATCCAGCGGGCCGGAAACGCCTATGGC
GGCCCGATGTTCGTCGGGACCAACAACGCGGTGCGCATCGCCGCGCTGCGGAGCATCGGC
GGGCTGTACGACTCGATCACCGAGGACATGGCCACCGGCTTCGAGCTGCACCGCCGCCGC
AACCCCGTCACCCGGAAGAAGTGGCGCTCGGTCTACACCCCGGACGTACTGGCCGTCGGA
GAGGGCCCGAGCACCTGGACGGACTTCTTCACCCAGCAGCTGCGCTGGAGCCGCGGCACC
TACGAGACGGTGCTCAAGCAGTTCTGGAAGGGGCCGTTCACGCTGTCGCCGGGGAAGCTG
CTCAACTACTCCCTGATGATCGCCTACTACCCGATGACCGCGCTCAACTGGATGCTCTCT
GCCCTGTCCTGCGCGCTGTTCCTGGTGCTCGGCGCGTCCGGGATCCATATCCCGGCGGAG
ATGTGGATGATGCTCTACAGCGACGCCGCGGCGCTCCAGATCGGCCTGTACATCTGGAAC
CGGCGGCACAACGTCTCCCCGCACGAACCGGAGGGCTCCGGCGGGGTGGCGGGGATGCTG
CTCTCCGCGCTGTCCGCCCCGATCTACGCCAAGTCGCTGTGCGACGCGCTGCTGCGGCGC
AAGAGCCGGTTCGTGGTCACGCCCAAGGGCGACTCCTCCAGCGCCGACCGGCTGTCCACC
TTCCGTATCCATCTGGTGTGGGCCGCGGTCTTCGGCGGCTCGCTGGTCGCCTCGCTGTTC
CTGGGCCACACCCACGCCGCGATGCGCACCTGGGCGATGCTGGCGCTGGCGCTGTGTCTG
GCGCCGATGGCCATCTGGTCCGGCGGGCTGCTGCTCACACGGCGCGGACGGCGCACCGCC
CCGGCGGTGCCGACGGCCCGCGCCGAGGCCCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-11]  0.316 Signal
Bacteria, Gram-negative   
TMHMM
 [435-457]  Transmembrane (o-i) [545-567]  Transmembrane (i-o) [571-593]  Transmembrane (o-i)
Transmembrane 3