close all open/close all
Nanch_00320 Nanch_00320   last last

CDS information : Nanch_00330


close this sectionLocation

Organism
StrainNS3226
Entry nameNanchangmycin
Contig
Start / Stop / Direction107,876 / 106,815 / - [in whole cluster]
107,876 / 106,815 / - [in contig]
Locationcomplement(106815..107876) [in whole cluster]
complement(106815..107876) [in contig]
TypeCDS
Length1,062 bp (353 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycosidase
Product (GenBank)NanG8
Gene
Gene (GenBank)nanG8
EC number3.2.1.-
Keyword
Note
Note (GenBank)
  • putative secreted endoglucanase
Reference
ACC
PmId
[12770825] A complete gene cluster from Streptomyces nanchangensis NS3226 encoding biosynthesis of the polyether ionophore nanchangmycin. (Chem Biol. , 2003)
Related Reference
ACC
P07984
PmId
[3023193] Characterization and structure of an endoglucanase gene cenA of Cellulomonas fimi. (Gene. , 1986)

close this sectionSequence

selected fasta
>putative glycosidase [NanG8]
MAEKGLGRATARHWAPLAGCAAALLALSGCLGTSGGSDRRSGLWVDPDNPAARQAREQRR
AGRYAEAELMRRIADEPIAEWLGPHPRERVRFITESAAREHRTPVLVAYHIPYRDCGRYS
RGGASSDAEYLDWIREIVSGIGERRAIVVLEPDAIAQVVDGCIPKPLRAPRLALLRDAVA
MLSAMPATRIYLDAGNPGWIKDTERLVEPLMKSGIDQADGFALNVSNFQPTAVTRAYGRR
LSLQLGRVHFIIDTSRNGNGPLTSVRGEGDDGKSGDMGAVRSASDGQESWCNPPGRALGD
PPSTRTGDPAIDAYLWIKRPGESDGTCNGGPPAGRWWTEYALDLARNARLRAR
selected fasta
>putative glycosidase [NanG8]
ATGGCCGAGAAAGGGCTCGGGAGAGCCACCGCGCGACATTGGGCGCCGCTTGCGGGATGT
GCCGCCGCGCTCCTCGCGCTGAGCGGATGTCTCGGCACGTCAGGCGGGTCGGACCGGCGG
AGCGGGCTATGGGTTGACCCGGACAACCCGGCCGCCCGGCAGGCCCGTGAGCAGCGGCGC
GCGGGCCGTTACGCGGAGGCGGAGCTCATGCGGCGGATCGCCGACGAGCCGATCGCCGAA
TGGCTCGGCCCGCATCCGCGCGAACGGGTCCGGTTTATCACCGAATCCGCAGCGCGGGAG
CACCGTACGCCGGTGCTGGTCGCCTATCACATTCCGTACCGGGACTGCGGAAGATACTCC
CGGGGCGGGGCGAGCAGCGACGCCGAATATCTGGACTGGATCCGTGAGATCGTCTCCGGA
ATCGGCGAGCGAAGGGCGATTGTCGTATTGGAGCCCGACGCGATCGCTCAGGTGGTCGAC
GGCTGCATTCCCAAGCCGCTGCGTGCGCCGCGGCTGGCCCTGCTGCGCGACGCGGTCGCC
ATGCTCTCCGCGATGCCCGCCACCCGGATCTATCTGGACGCCGGGAACCCGGGGTGGATC
AAGGACACCGAGCGGCTGGTGGAGCCGCTGATGAAAAGCGGTATCGACCAGGCGGACGGC
TTCGCCCTGAACGTCTCGAACTTCCAGCCGACAGCGGTGACCCGCGCCTACGGCCGTCGG
CTGTCCCTCCAGCTCGGCAGGGTCCACTTCATCATCGACACCAGCCGCAACGGCAACGGC
CCGCTCACCTCCGTCAGGGGCGAGGGCGACGACGGCAAGAGCGGTGACATGGGCGCCGTG
CGCTCCGCCAGCGACGGCCAGGAGAGCTGGTGCAACCCGCCGGGGCGGGCTCTGGGGGAT
CCCCCCAGCACCCGTACGGGCGACCCCGCCATCGACGCGTATCTGTGGATCAAGCGTCCG
GGAGAGTCCGACGGGACCTGCAACGGCGGTCCGCCCGCAGGTCGTTGGTGGACGGAGTAC
GCGCTCGACCTGGCCCGTAACGCCAGGTTGCGCGCCAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001524 Glycoside hydrolase, family 6, conserved site (Conserved_site)
 [147-156]  PS00656
PS00656   GLYCOSYL_HYDROL_F6_2
IPR016288 1, 4-beta cellobiohydrolase (Family)
 [42-348]  2.20000000000002e-79 G3DSA:3.20.20.40
G3DSA:3.20.20.40   Glyco_hydro_6
 [63-82]  3.49999466863949e-38 PR00733 [102-115]  3.49999466863949e-38 PR00733 [130-145]  3.49999466863949e-38 PR00733 [187-200]  3.49999466863949e-38 PR00733 [218-228]  3.49999466863949e-38 PR00733 [248-261]  3.49999466863949e-38 PR00733 [287-307]  3.49999466863949e-38 PR00733 [311-325]  3.49999466863949e-38 PR00733
PR00733   GLHYDRLASE6
 [35-353]  8.99992502689852e-84 SSF51989
SSF51989   Glyco_hydro_6
 [46-338]  7.90000000000016e-78 PF01341
PF01341   Glyco_hydro_6
 [1-352]  PIRSF001100
PIRSF001100   Beta_cellobiohydrolase
SignalP
 [1-32]  0.999 Signal
Eukaryota   
 [1-36]  0.557 Signal
Bacteria, Gram-positive   
 [1-35]  0.57 Signal
Bacteria, Gram-negative   
TMHMM
 [13-35]  Transmembrane (i-o)
Transmembrane 1   
Nanch_00320 Nanch_00320   last last