close all open/close all
Naphcy_00020 Naphcy_00020   last last

CDS information : Naphcy_00010


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction12,605 / 11,340 / - [in whole cluster]
1,436 / 2,701 / + [in contig]
Locationcomplement(11340..12605) [in whole cluster]
1436..2701 [in contig]
TypeCDS
Length1,266 bp (421 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase beta-ketoacyl synthase subunit
Product (GenBank)beta-ketoacyl synthase/acyl transferase
Gene
Gene (GenBank)ncnA
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)

close this sectionPKS/NRPS Module

KS3..375

close this sectionSequence

selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [beta-ketoacyl synthase/acyl transferase]
MTRRVVITGIGVRTPGGLGTKAFWSLLSEGRTATRRISRFDPSPFRSRIAGEVDFDAEAE
GFSPREVRRMDRATQFAVACTRDAVADSGLETTALDPARVGVSLGSAVASATSLEREYLV
LSDSGRQWLVDDGFLSPHMADYLSPGVMPAEVAWSVGAEGPVTMVSDGCTSGLDAVGHGV
QLIREGTVDVVLAGASDTPVSPIVVACFDAIKATTPRNDDPEHASRPFDGSRNGFVLAEG
AAMFVLEEYEAARARGAQIYAEVGGFATRCNAYHMTGLKTDGREMAEAIRAALDEARLDR
TAVDYVNAHGSGTKQNDRHETAALKRSLGAHAYDVPVSSIKSMVGHSLGAIGSIEIAACA
LAIKTNVVPPTANLHTPDPECDLDYVPLTARDKQVDTVLSVGSGFGGFQSAMVLHRPEVA
A
selected fasta
>polyketide synthase beta-ketoacyl synthase subunit [beta-ketoacyl synthase/acyl transferase]
ATGACTCGGCGCGTTGTGATCACCGGCATCGGGGTGCGTACCCCGGGCGGCCTGGGAACG
AAGGCGTTCTGGTCGCTGCTCAGCGAGGGGCGGACGGCCACCCGGAGGATCTCCCGTTTC
GACCCCTCCCCCTTCAGGTCCCGGATCGCGGGCGAGGTGGACTTCGACGCGGAGGCGGAG
GGGTTCAGCCCGCGCGAGGTGCGCAGGATGGACCGCGCGACCCAGTTCGCCGTCGCCTGC
ACCCGGGACGCGGTCGCCGACAGCGGACTGGAGACCACCGCTCTGGACCCGGCCCGCGTC
GGCGTGAGCCTGGGCAGCGCGGTGGCGTCCGCGACCAGCCTGGAGCGGGAGTACCTGGTG
CTGTCCGACAGCGGCCGGCAGTGGCTGGTGGACGACGGTTTCCTCTCCCCGCACATGGCC
GACTACCTCAGTCCGGGGGTGATGCCGGCCGAGGTGGCCTGGAGCGTGGGCGCCGAGGGC
CCGGTGACGATGGTCTCCGACGGCTGCACCTCCGGCCTGGACGCGGTCGGGCACGGCGTC
CAGCTGATCCGGGAGGGAACCGTCGACGTCGTCCTCGCGGGCGCGTCCGACACCCCGGTC
TCGCCGATCGTCGTCGCCTGCTTCGACGCCATCAAGGCGACCACACCCCGCAACGACGAC
CCGGAGCACGCCTCCCGGCCGTTCGACGGCTCGCGCAACGGCTTCGTCCTGGCGGAGGGC
GCCGCGATGTTCGTCCTCGAGGAGTACGAGGCGGCCCGGGCCCGCGGCGCGCAGATCTAC
GCCGAGGTCGGCGGGTTCGCGACCCGCTGCAACGCCTACCACATGACCGGTCTGAAGACG
GACGGCCGGGAGATGGCCGAGGCGATCCGGGCGGCGCTCGACGAGGCCCGCCTCGACCGG
ACCGCCGTCGACTACGTCAACGCGCACGGCTCCGGCACCAAGCAGAACGACCGCCACGAG
ACCGCCGCGCTCAAGCGCAGCCTGGGCGCGCACGCCTACGACGTGCCGGTCAGCTCCATC
AAGTCGATGGTCGGGCACTCGCTGGGCGCCATCGGGTCCATCGAGATCGCCGCCTGCGCG
CTCGCCATCAAAACCAACGTCGTACCGCCCACCGCCAATCTGCACACCCCCGACCCCGAG
TGCGACCTGGACTACGTGCCGCTGACCGCCCGCGACAAGCAGGTGGACACCGTGCTGTCG
GTCGGCAGCGGGTTCGGCGGGTTCCAGAGCGCGATGGTGCTGCACCGGCCGGAGGTCGCC
GCATGA
KS3..375
KS7..1125

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [3-251]  4.39999999999996e-62 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [260-375]  2.4e-37 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [3-263]  1.99999999999999e-67 G3DSA:3.40.47.10 [270-417]  7.89999999999997e-53 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [2-257]  3.99998544139406e-70 SSF53901 [219-418]  1.40000506907309e-64 SSF53901
SSF53901   Thiolase-like
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [160-176]  PS00606
PS00606   B_KETOACYL_SYNTHASE
SignalP No significant hit
TMHMM No significant hit
Naphcy_00020 Naphcy_00020   last last