close all open/close all

CDS information : Naphcy_00020


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction11,343 / 10,054 / - [in whole cluster]
2,698 / 3,987 / + [in contig]
Locationcomplement(10054..11343) [in whole cluster]
2698..3987 [in contig]
TypeCDS
Length1,290 bp (429 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)chain length factor
Gene
Gene (GenBank)ncnB
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)

close this sectionPKS/NRPS Module

CLF26..384

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
MNSGTRSGTSSATRNGTSSGAAGAGAVVVTGVSVVAPGGLGTEEYWKSVLTGRSGIGELT
RFDVTRYPARLAGQIRDFEAADHLPSRSLPQTDVSTCHALAAAAWALADAGVGAGTLPDY
DMGVVTSTSQGGFEFTHREFNKLWSKGPQHVSVYESFAWFYAVNTGQISIRHGMRGPSAA
LVAEQAGGLDAVGHARRTVRRGTRLVLSGGVDSAFDPWGWVAQSASGRVTTATDPERAYL
PFDTDASGHVPAEGGAILVVEDAASARLRGAERIYGTLAGYASTFDPRPGSGRPPGLRRA
AELALADAGLAPGDIDVVFADAAGVPELDRAEAAAISGLFGPNAVPVTAPKSVTGRMYAG
GGPADLVAALLAVRDGVVPATAHTTSVPAGYGIDLVLGEPRALPVRAALVLARGRWGFNS
AVVVTGPTH
selected fasta
>polyketide synthase chain length factor subunit [chain length factor]
ATGAACAGCGGTACGAGGAGCGGTACGAGCAGCGCTACGAGGAACGGTACGAGCAGCGGC
GCGGCCGGTGCCGGTGCCGTGGTCGTCACCGGTGTCTCGGTGGTGGCGCCGGGCGGTCTG
GGGACCGAGGAGTACTGGAAGTCCGTGCTCACCGGGCGCAGCGGCATCGGGGAGCTCACC
CGGTTCGACGTCACGCGCTACCCGGCCCGGCTCGCCGGGCAGATCAGGGACTTCGAGGCG
GCCGACCACCTGCCCAGCCGGTCGCTGCCGCAGACGGACGTCTCGACCTGCCACGCGCTG
GCCGCCGCGGCCTGGGCGCTGGCCGACGCCGGGGTGGGCGCCGGGACACTGCCCGACTAC
GACATGGGCGTGGTCACCTCCACCTCGCAGGGCGGGTTCGAGTTCACCCACCGGGAGTTC
AACAAGCTCTGGAGCAAGGGCCCGCAGCACGTCAGCGTCTACGAGTCGTTCGCCTGGTTC
TACGCCGTGAACACCGGGCAGATCTCCATCCGGCACGGCATGCGCGGCCCGAGCGCCGCG
CTCGTCGCGGAGCAGGCGGGCGGCCTGGACGCGGTGGGGCACGCCCGCCGTACCGTGCGC
CGGGGCACCCGGCTGGTGCTGAGCGGCGGGGTGGACTCCGCGTTCGATCCGTGGGGCTGG
GTGGCGCAGTCGGCGAGCGGCCGGGTCACCACGGCGACCGACCCGGAGCGCGCGTACCTG
CCCTTCGACACCGACGCGTCCGGGCACGTGCCCGCCGAGGGCGGCGCGATCCTGGTCGTC
GAGGACGCCGCCTCGGCCCGGCTGCGCGGCGCGGAGCGGATCTACGGGACGCTCGCCGGA
TACGCGTCCACCTTCGACCCGCGGCCCGGTTCGGGACGCCCGCCAGGCCTGCGCCGCGCG
GCCGAACTGGCGCTGGCCGACGCGGGGTTGGCGCCTGGCGACATCGACGTGGTGTTCGCC
GACGCGGCCGGCGTGCCGGAACTCGACCGGGCCGAGGCGGCGGCCATCAGCGGCCTGTTC
GGGCCGAACGCCGTCCCGGTGACCGCGCCCAAGTCCGTCACCGGCCGGATGTACGCGGGC
GGCGGTCCGGCCGACCTGGTCGCCGCGCTGCTCGCCGTCCGGGACGGCGTGGTCCCGGCG
ACCGCGCACACCACGTCGGTGCCCGCCGGCTACGGCATCGACCTCGTCCTCGGGGAACCC
CGCGCCCTGCCCGTACGGGCCGCGCTGGTGCTCGCCCGCGGACGCTGGGGCTTCAACTCG
GCGGTCGTCGTGACCGGTCCGACGCACTGA
CLF26..384
CLF76..1152

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [26-262]  8.50000000000004e-53 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [275-384]  4.10000000000001e-26 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [26-279]  1.29999999999998e-51 G3DSA:3.40.47.10 [292-425]  1.70000000000001e-34 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [24-271]  1.10000150671643e-57 SSF53901 [234-427]  2.50000909916183e-45 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-36]  0.74 Signal
Bacteria, Gram-positive   
 [1-35]  0.704 Signal
Bacteria, Gram-negative   
 [1-41]  0.466 Signal
Eukaryota   
TMHMM No significant hit