close all open/close all

CDS information : Naphcy_00030


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction10,009 / 9,749 / - [in whole cluster]
4,032 / 4,292 / + [in contig]
Locationcomplement(9749..10009) [in whole cluster]
4032..4292 [in contig]
TypeCDS
Length261 bp (86 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)acyl carrier protein
Gene
Gene (GenBank)ncnC
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)

close this sectionPKS/NRPS Module

ACP5..78

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
MAHIQIDDLRRILVACAGEDDGIDLSGDILDTSFGDLGYDSLALMETAARIERDYGVALA
DDVIADARTPRDLLDLVNRAVPADAR
selected fasta
>polyketide synthase acyl carrier protein subunit [acyl carrier protein]
ATGGCACACATCCAGATCGACGACCTGCGGCGCATCCTCGTCGCCTGCGCCGGCGAGGAC
GACGGCATCGACCTGAGCGGCGACATCCTCGACACCTCCTTCGGTGACCTGGGGTACGAC
TCGCTCGCCCTGATGGAGACCGCCGCCCGGATCGAACGGGACTACGGGGTCGCCCTCGCG
GACGACGTGATCGCCGACGCGAGGACGCCGCGCGACCTGCTCGACCTGGTCAACCGGGCC
GTCCCGGCGGACGCCCGGTGA
ACP5..78
ACP13..234

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [36-51]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [5-78]  PS50075
PS50075   ACP_DOMAIN
 [7-80]  9.10000000000001e-17 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1-86]  9.00000407957274e-17 SSF47336
SSF47336   ACP_like
 [23-77]  1.1e-10 PF00550
PF00550   PP-binding
SignalP No significant hit
TMHMM No significant hit