close all open/close all

CDS information : Naphcy_00040


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction9,752 / 8,805 / - [in whole cluster]
4,289 / 5,236 / + [in contig]
Locationcomplement(8805..9752) [in whole cluster]
4289..5236 [in contig]
TypeCDS
Length948 bp (315 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)aromatase
Gene
Gene (GenBank)ncnD
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)

close this sectionSequence

selected fasta
>cyclase/dehydratase [aromatase]
MTAGPRPLHAEHTRVVHAPPGPLYDLVADVTLWPAVFGPTVHARRLEGGPDSERIRLWAT
VNGRVSDWVSRRTLDPGRFTVGFEQEVSSAPVASMGGEWLFRELGGGRTEVVLRHHFTVV
DDDPAAVSWVQEALDRNSAAELGALARVVETGHPPREIVFSFTDTLALTGPAESAYEFVA
RADLWPERLPHVAGVTLTETAPGVQDLRMETATADGSTHTTHSVRVCRRPEWIAYKQLRT
PELLLGHSGLWTFGEGPDGPFATASHTVALNPEAVSRVLGADRTTADARRHVRELLGRNS
RTTLAHAAGQEAPAR
selected fasta
>cyclase/dehydratase [aromatase]
GTGACGGCCGGACCCCGCCCGCTGCACGCCGAGCACACCCGGGTGGTGCACGCGCCGCCC
GGTCCGCTGTACGACCTGGTGGCGGACGTGACGCTGTGGCCGGCCGTCTTCGGCCCCACC
GTGCACGCCCGCCGGCTGGAAGGCGGCCCGGACAGCGAGCGGATCCGGCTCTGGGCGACG
GTGAACGGCCGGGTGAGCGACTGGGTGTCGCGCCGCACCCTCGATCCGGGCCGGTTCACG
GTCGGCTTCGAGCAGGAGGTCAGCAGTGCGCCGGTCGCCTCGATGGGCGGCGAGTGGCTC
TTCCGTGAGCTGGGCGGCGGCCGGACCGAGGTCGTCCTGCGGCACCACTTCACGGTCGTC
GACGACGACCCGGCCGCCGTGTCCTGGGTGCAGGAGGCGCTGGACCGCAACAGCGCGGCG
GAACTCGGCGCGCTGGCCCGGGTCGTGGAGACCGGGCACCCGCCGCGGGAGATCGTGTTC
TCGTTCACCGACACCCTCGCGCTGACCGGCCCGGCGGAGTCGGCCTACGAGTTCGTCGCC
CGGGCCGACCTGTGGCCGGAGCGGCTTCCGCACGTGGCCGGGGTGACCCTCACCGAGACC
GCGCCCGGGGTGCAGGACCTGCGGATGGAGACGGCGACGGCGGACGGCTCGACCCACACC
ACCCATTCGGTACGGGTGTGCCGGCGGCCGGAGTGGATCGCGTACAAGCAGCTCCGTACC
CCGGAGCTGCTGCTCGGGCACAGCGGGCTGTGGACGTTCGGCGAGGGACCGGACGGACCG
TTCGCCACCGCGAGCCACACGGTGGCCCTGAACCCGGAGGCGGTGTCCCGGGTGCTGGGG
GCGGACCGCACGACCGCGGACGCCCGACGGCACGTGCGGGAACTGCTCGGCCGCAACAGC
CGCACCACGCTGGCGCACGCGGCCGGACAGGAGGCACCGGCCCGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005031 Streptomyces cyclase/dehydrase (Family)
 [171-270]  0.00012 PF03364
PF03364   Polyketide_cyc
IPR019587 Polyketide cyclase/dehydrase (Family)
 [9-150]  5e-10 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [10-119]  7.4e-16 G3DSA:3.30.530.20 [164-259]  7.4e-16 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP
 [1-10]  0.316 Signal
Bacteria, Gram-negative   
TMHMM No significant hit