close all open/close all
first first   Naphcy_00060 Naphcy_00060

CDS information : Naphcy_00050


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction1,679 / 1,071 / - [in whole cluster]
1,679 / 1,071 / - [in contig]
Locationcomplement(1071..1679) [in whole cluster]
complement(1071..1679) [in contig]
TypeCDS
Length609 bp (202 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative LuxR family transcriptional regulator
Product (GenBank)regulator
Gene
Gene (GenBank)ncnR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)
Related Reference
ACC
Q54821
NITE
Adria_00100
PmId
[7868594] Regulation of daunorubicin production in Streptomyces peucetius by the dnrR2 locus. (J Bacteriol. , 1995)
[8892835] The DnrN protein of Streptomyces peucetius, a pseudo-response regulator, is a DNA-binding protein involved in the regulation of daunorubicin biosynthesis. (J Bacteriol. , 1996)
[10846224] The dnrO gene encodes a DNA-binding protein that regulates daunorubicin production in Streptomyces peucetius by controlling expression of the dnrN pseudo response regulator gene. (Microbiology. , 2000)
[20122958] The activator/repressor protein DnrO of Streptomyces peucetius binds to DNA without changing its topology. (Int J Biol Macromol. , 2010)
[20529134] Modulation of dnrN expression by intracellular levels of DnrO and daunorubicin in Streptomyces peucetius. (FEMS Microbiol Lett. , 2010)
[20158521] Daunorubicin efflux in Streptomyces peucetius modulates biosynthesis by feedback regulation. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>putative LuxR family transcriptional regulator [regulator]
MIRVLLAEDMGMVRGALVALMEMEQDLSVVAQVADGREVLSAGLAHRPDVAVIDVGLPGV
DGIEAAAQLHEHLPECRTLMLTGTDQPGTVRRAMDARVFGYLLKDAPPSELAAAIRKVAD
GQRVIDTRLAFTVWQRGDHPLTERESDVLSLASEGAEASEIAAQLHLAVGTVRNYLSSAV
TKLGARNRLDAVRIARDAGWIG
selected fasta
>putative LuxR family transcriptional regulator [regulator]
GTGATTCGCGTCTTGCTCGCCGAGGACATGGGGATGGTGCGAGGGGCGCTGGTGGCGCTG
ATGGAGATGGAGCAGGATCTCAGTGTCGTGGCGCAGGTGGCCGACGGGCGCGAGGTCCTC
TCCGCCGGGCTGGCGCACCGCCCAGACGTCGCCGTGATCGACGTGGGACTTCCCGGGGTG
GACGGCATCGAGGCCGCGGCCCAGTTGCACGAGCACCTGCCGGAGTGCCGGACCCTGATG
CTCACCGGCACGGACCAGCCGGGCACCGTGCGCCGGGCGATGGACGCCAGGGTCTTCGGC
TACCTGCTCAAGGACGCCCCGCCGTCGGAGCTGGCCGCGGCGATCCGCAAGGTGGCGGAC
GGCCAGCGGGTGATCGACACCCGGCTGGCCTTCACCGTATGGCAGCGCGGCGACCATCCG
CTGACCGAGCGGGAGTCCGACGTCCTGTCACTGGCGTCGGAAGGGGCTGAGGCCTCGGAG
ATCGCCGCCCAGCTTCACCTGGCCGTCGGTACCGTCCGGAACTACCTGAGTTCGGCGGTG
ACCAAGCTGGGCGCCCGCAACCGTCTCGACGCGGTGCGGATCGCCCGGGACGCCGGCTGG
ATCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000792 Transcription regulator LuxR, C-terminal (Domain)
 [139-195]  1.4e-14 PF00196
PF00196   GerE
 [138-195]  8.20001307135067e-24 SM00421
SM00421   HTH_LUXR
 [141-155]  7.09999884211141e-10 PR00038 [155-171]  7.09999884211141e-10 PR00038 [171-183]  7.09999884211141e-10 PR00038
PR00038   HTHLUXR
 [155-182]  PS00622
PS00622   HTH_LUXR_1
 [134-199]  PS50043
PS50043   HTH_LUXR_2
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [2-115]  5.29999657550189e-25 SM00448
SM00448   REC
 [4-115]  1.99999999999999e-19 PF00072
PF00072   Response_reg
 [3-119]  PS50110
PS50110   RESPONSE_REGULATORY
IPR011006 CheY-like superfamily (Domain)
 [1-132]  1.79999754022375e-28 SSF52172
SSF52172   CheY_like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [119-201]  1.4e-23 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016032 Signal transduction response regulator, C-terminal effector (Domain)
 [119-201]  5.69999708783953e-19 SSF46894
SSF46894   Bipartite_resp_reg_C-effector
SignalP No significant hit
TMHMM No significant hit
first first   Naphcy_00060 Naphcy_00060