close all open/close all

CDS information : Naphcy_00060


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction2,030 / 2,962 / + [in whole cluster]
2,030 / 2,962 / + [in contig]
Location2030..2962 [in whole cluster]
2030..2962 [in contig]
TypeCDS
Length933 bp (310 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase/dehydratase
Product (GenBank)cyclase
Gene
Gene (GenBank)ncnE
EC number
Keyword
  • 2nd ring
Note
Note (GenBank)
Reference
ACC
PmId
[10206788] Isolation and characterization of the naphthocyclinone gene cluster from Streptomyces arenae DSM 40737 and heterologous expression of the polyketide synthase genes. (Gene. , 1999)
Related Reference
ACC
Q93IZ0
NITE
Actino_00220
PmId
[11851466] Genetic Contributions to Understanding Polyketide Synthases. (Chem Rev. , 1997)

close this sectionSequence

selected fasta
>cyclase/dehydratase [cyclase]
MTDERRQDRTAPDDAWLEEVADGVFAYVQPDGGWCLNNAGLVVSDGRAALVDTAATETRA
RRLREAVRGVTAAPPGVLVNTHFHGDHTFGNFVFPEALVVGHERTRSEALAAGLHLTGLW
PDVRWGALELAPPALTYRDGVTLHVGDVRVEVLHPGPAHTTDDSVVWLPEQRVLFTGDIV
MPGVTPFCAMGSVSGSLAVLDRLRALGARTVVPGHGPVAGPEVFDATESYLRWVRATARR
GLADRLTPMQVARACDLGEFAGLRDSERLLPNLRRAYAEEQGAAPGAPLDIGELFAEMIE
FHGRLPTCRA
selected fasta
>cyclase/dehydratase [cyclase]
GTGACCGACGAACGGCGGCAGGACCGCACGGCCCCGGACGACGCGTGGCTGGAGGAGGTG
GCGGACGGCGTCTTCGCCTACGTCCAGCCGGACGGCGGCTGGTGCCTGAACAACGCCGGT
CTCGTCGTGTCCGACGGCCGGGCGGCGCTCGTCGACACCGCCGCGACCGAGACCCGGGCC
CGCCGCCTGCGGGAGGCCGTGCGCGGGGTGACGGCGGCACCCCCCGGCGTCCTGGTCAAC
ACCCACTTCCACGGCGACCACACCTTCGGCAACTTCGTCTTCCCCGAAGCGCTGGTCGTC
GGCCACGAACGGACCCGCAGCGAGGCGCTGGCGGCCGGCCTGCACCTCACCGGCCTGTGG
CCCGACGTGCGCTGGGGCGCCCTCGAACTGGCGCCCCCGGCCCTCACCTACCGCGACGGG
GTGACCCTGCACGTGGGAGACGTGCGCGTCGAGGTGCTGCACCCGGGCCCGGCGCACACG
ACGGACGACTCGGTCGTCTGGCTGCCCGAGCAGAGGGTGCTGTTCACCGGGGACATCGTC
ATGCCGGGCGTCACGCCGTTCTGCGCGATGGGATCGGTCAGCGGATCCCTCGCCGTCCTC
GACCGGCTGCGCGCACTGGGCGCCCGTACCGTGGTGCCGGGCCACGGCCCGGTCGCGGGC
CCCGAGGTGTTCGACGCCACCGAGAGCTACCTGCGGTGGGTCCGGGCGACGGCACGGCGC
GGCCTGGCCGACCGGCTCACCCCCATGCAGGTCGCCCGCGCCTGCGACCTGGGCGAGTTC
GCCGGGCTCCGCGACTCCGAACGGCTACTGCCGAACCTGCGCCGCGCCTACGCGGAGGAG
CAGGGTGCGGCCCCCGGGGCGCCGCTGGACATAGGGGAGCTGTTCGCCGAGATGATCGAG
TTTCACGGCCGGCTGCCGACCTGCCGGGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [33-215]  4.9e-24 PF00753
PF00753   Lactamase_B
 [36-215]  2.1000026783403e-34 SM00849
SM00849   Lactamase_B
SignalP
 [1-35]  0.036 Signal
Eukaryota   
TMHMM No significant hit