close all open/close all

CDS information : Naphcy_00070


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction3,984 / 4,553 / + [in whole cluster]
3 / 572 / + [in contig]
Location3984..4553 [in whole cluster]
3..572 [in contig]
TypeCDS
Length570 bp (189 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)Ncn-orf3
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11816965] Heterologous expression of the naphthocyclinone hydroxylase gene from Streptomyces arenae for production of novel hybrid polyketides. (Antonie Van Leeuwenhoek. , 2001)
Family/Domain
FD
IPR011251

close this sectionSequence

selected fasta
>putative oxidoreductase [Ncn-orf3]
MPVYLAAVGPRSLRLAGEIADGWLGVFTPPDAVAKAVTEIRAGRESGRAGPDRLRGPAQP
AGVGRGRRAHRGDALRGQYVYLLGIGDPAHNFYCALAREMGYAEEIEVFLGRLADGDRAG
AAAALPLDFIDRTSLAGPVPRLADRMRAYAEAGVTTLGVMVSAAATTLDGRLGILHAAAE
ALKASGVAD
selected fasta
>putative oxidoreductase [Ncn-orf3]
ATCCCGGTCTACCTGGCGGCGGTGGGGCCCCGCAGCCTGCGGCTCGCGGGCGAGATCGCG
GACGGCTGGCTCGGGGTGTTCACCCCGCCCGACGCGGTCGCCAAGGCCGTCACCGAGATC
CGGGCGGGCCGGGAGAGCGGCCGGGCGGGACCTGACCGGCTTCGAGGTCCTGCCCAGCCT
GCCGGCGTCGGTCGCGGACGACGTGCCCACCGCGGTGACGCGTTGCGCGGCCAGTACGTC
TACCTGCTGGGCATCGGCGACCCCGCGCACAACTTCTACTGCGCGCTGGCCCGCGAGATG
GGCTACGCCGAGGAGATCGAGGTCTTCCTCGGGCGGCTGGCCGACGGCGACCGGGCCGGT
GCGGCGGCCGCGCTGCCGCTGGACTTCATCGACCGCACCTCGCTCGCGGGACCGGTGCCC
CGGCTCGCCGACCGGATGCGGGCGTACGCGGAGGCCGGCGTGACCACCCTCGGGGTCATG
GTGTCGGCGGCGGCGACGACCCTGGACGGCCGACTGGGCATCCTGCACGCGGCGGCCGAG
GCCCTGAAGGCATCGGGGGTCGCCGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011251 Luciferase-like domain (Domain)
 [2-155]  7.9e-16 PF00296
PF00296   Bac_luciferase
 [1-180]  2e-17 G3DSA:3.20.20.30
G3DSA:3.20.20.30   no description
 [1-182]  2.1e-17 SSF51679
SSF51679   Bacterial luciferase-like
SignalP
 [1-34]  0.264 Signal
Bacteria, Gram-negative   
TMHMM No significant hit