close all open/close all

CDS information : Naphcy_00080


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction4,698 / 5,561 / + [in whole cluster]
717 / 1,580 / + [in contig]
Location4698..5561 [in whole cluster]
717..1580 [in contig]
TypeCDS
Length864 bp (287 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)Ncn-orf2
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[11816965] Heterologous expression of the naphthocyclinone hydroxylase gene from Streptomyces arenae for production of novel hybrid polyketides. (Antonie Van Leeuwenhoek. , 2001)
Related Reference
ACC
Q93IZ2
NITE
Actino_00090
PmId
[1766437] Organisation and functions of the actVA region of the actinorhodin biosynthetic gene cluster of Streptomyces coelicolor. (Mol Gen Genet. , 1991)

close this sectionSequence

selected fasta
>hypothetical protein [Ncn-orf2]
MTYTRHASDTGFRRTGGRSRCSPTSSGSRMPAWQPDGLPPGWLARPAAGLPAGDGTARVT
PEGLVVAPPGTDPAHPRTPVRRPAPSAPLGHLRWAAFAGTATPPGFTLPDTGLLTAHMEL
AAEVYGPGADRPTAAGIADTRHGMGGMLCVDLGSGLVLDFLLTNDRVWVLYERLGRPGAG
HGTFTYEVPVAERSPGRRHRCAIRVDRARGTAVWLLDGTEVFAVPDLGRRLPSRAAHITR
SADGPEESVRPGRLALGIGLFGELAEGSGVRLTVRRATVTRSTPGTS
selected fasta
>hypothetical protein [Ncn-orf2]
GTGACGTACACACGACATGCCAGTGATACGGGATTCCGGCGGACGGGCGGGAGGAGCCGG
TGTTCGCCGACGAGTTCCGGCTCCCGGATGCCGGCCTGGCAGCCGGACGGGCTGCCCCCG
GGATGGCTGGCCCGTCCCGCCGCCGGGCTGCCCGCCGGTGACGGGACCGCCCGCGTCACC
CCGGAGGGCCTGGTGGTGGCACCCCCGGGCACGGACCCGGCCCACCCGCGAACCCCGGTT
CGCCGTCCCGCCCCGTCGGCGCCGCTGGGCCACCTGCGCTGGGCCGCCTTCGCCGGCACC
GCCACCCCACCCGGCTTCACCCTGCCCGACACCGGACTCCTCACCGCCCACATGGAGCTG
GCCGCCGAGGTGTACGGCCCGGGTGCGGACCGTCCGACCGCGGCCGGCATCGCCGACACC
CGGCACGGGATGGGCGGGATGCTCTGTGTGGATCTGGGGTCCGGGCTGGTGCTCGACTTC
CTGCTGACCAATGACCGGGTCTGGGTGCTGTACGAGCGGCTCGGCCGGCCCGGCGCCGGT
CACGGCACGTTCACGTACGAGGTCCCGGTCGCCGAGCGGTCGCCTGGCCGTCGGCACCGG
TGTGCGATACGCGTCGACCGGGCCCGCGGCACCGCGGTGTGGCTGCTGGACGGCACGGAG
GTGTTCGCCGTGCCGGACCTCGGCCGTCGCCTCCCGTCCCGCGCCGCCCACATCACCCGC
TCCGCCGACGGCCCCGAGGAGAGCGTCCGGCCCGGCCGGCTCGCCCTCGGCATCGGCCTG
TTCGGCGAACTCGCGGAAGGGTCCGGGGTACGCCTCACGGTCCGCCGGGCCACCGTGACA
CGCTCCACCCCCGGCACGTCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit