close all open/close all

CDS information : Naphcy_00090


close this sectionLocation

Organism
StrainDSM 40737
Entry nameNaphthocyclinone
Contig
Start / Stop / Direction6,885 / 5,668 / - [in whole cluster]
2,904 / 1,687 / - [in contig]
Locationcomplement(5668..6885) [in whole cluster]
complement(1687..2904) [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative FMNH2-dependent monooxygenase
Product (GenBank)hydroxylase NcnH
Gene
Gene (GenBank)ncnH
EC number
Keyword
  • two-component system
  • hydroxylate
Note
Note (GenBank)
Reference
ACC
PmId
[11816965] Heterologous expression of the naphthocyclinone hydroxylase gene from Streptomyces arenae for production of novel hybrid polyketides. (Antonie Van Leeuwenhoek. , 2001)
Related Reference
ACC
Q53907
NITE
Actino_00110
PmId
[18245777] Mechanism and regulation of the Two-component FMN-dependent monooxygenase ActVA-ActVB from Streptomyces coelicolor. (J Biol Chem. , 2008)
[19246012] Biosynthesis of actinorhodin and related antibiotics: discovery of alternative routes for quinone formation encoded in the act gene cluster. (Chem Biol. , 2009)
[22086671] Epoxyquinone formation catalyzed by a two-component flavin-dependent monooxygenase involved in biosynthesis of the antibiotic actinorhodin. (Chembiochem. , 2011)
[23601640] Biosynthetic conclusions from the functional dissection of oxygenases for biosynthesis of actinorhodin and related streptomyces antibiotics. (Chem Biol. , 2013)

close this sectionSequence

selected fasta
>putative FMNH2-dependent monooxygenase [hydroxylase NcnH]
MPDDAQTRPTLTPTAPALTADPTAPAIPVGPVALVQRARDLAELAGKHAGDADRERRLHP
DVVRAVAEAGFGRHFVPVRWGGADGTFADLLAAVARVGEGCTSAAWVAALAATVPRMAAH
LPRQGQAEVWSDGPDTLLVGALMPLGRAERAAGGWRLTGTWSYVSGVDFSDWALVCARTA
EDGVEVPRYFALPREAYAIRDTWFTVGMRGTGSNTLSVDDVYVPDHRVCTRAAVLDGDCP
DAPADCTRVPLKAVNGLSFAAPVLGAAKGLLAEWTRWAAPRITGTGDGDPRLAENALRHG
VLARAAGEVDGAELLLDRTARAADTGALDPLLTARGGRDCALAAELLLTAADRLFRAAGT
SAQVEGSPFERGWRDVSAAVSHLVLRFEPAATAYAQAVLTAQQEP
selected fasta
>putative FMNH2-dependent monooxygenase [hydroxylase NcnH]
ATGCCCGACGACGCACAGACCCGGCCGACCCTCACCCCGACCGCACCGGCTCTGACGGCC
GACCCGACCGCACCGGCCATCCCGGTCGGCCCGGTCGCCCTCGTCCAGCGGGCTCGGGAT
CTCGCGGAGCTGGCGGGCAAGCACGCCGGTGACGCGGACCGGGAGCGGCGGCTCCATCCC
GACGTGGTGCGCGCGGTCGCGGAGGCGGGGTTCGGGCGGCACTTCGTGCCGGTCCGCTGG
GGCGGCGCCGACGGCACCTTCGCCGACCTGCTGGCCGCGGTCGCCCGCGTCGGCGAGGGC
TGCACGTCCGCCGCGTGGGTCGCCGCACTGGCCGCCACCGTGCCGCGCATGGCCGCCCAT
CTGCCCCGCCAGGGGCAGGCCGAGGTCTGGTCCGACGGCCCGGACACCCTGCTCGTCGGC
GCCCTGATGCCGCTCGGCCGGGCGGAACGGGCGGCCGGCGGCTGGCGGCTGACCGGCACC
TGGTCGTACGTCAGCGGTGTCGACTTCTCCGACTGGGCCCTGGTGTGCGCGCGGACGGCG
GAGGACGGCGTCGAGGTGCCACGGTACTTCGCGCTGCCCCGCGAGGCGTACGCGATCCGG
GACACCTGGTTCACCGTCGGGATGCGCGGCACCGGCAGCAACACCCTCTCCGTGGACGAC
GTGTACGTCCCGGACCACCGGGTGTGCACCCGCGCGGCCGTGCTGGACGGCGACTGCCCG
GACGCGCCCGCCGACTGCACCCGGGTGCCGCTGAAAGCGGTGAACGGCCTGTCCTTCGCG
GCACCGGTCCTGGGGGCCGCGAAGGGGCTGCTGGCGGAGTGGACGCGCTGGGCCGCACCC
CGGATCACGGGGACCGGCGACGGCGATCCCCGGCTCGCGGAGAACGCGCTGCGGCACGGG
GTGCTGGCCCGCGCCGCCGGGGAGGTGGACGGCGCCGAACTGCTGCTGGACCGTACCGCC
CGGGCGGCCGACACGGGGGCGCTCGACCCGCTGCTGACCGCGCGCGGCGGCCGGGACTGC
GCGCTCGCCGCGGAGCTGCTGCTGACCGCGGCGGACCGGCTGTTCCGGGCCGCGGGCACG
TCCGCGCAGGTCGAGGGGAGCCCGTTCGAACGCGGCTGGCGTGATGTCAGCGCGGCGGTG
AGCCATCTGGTGCTGCGCTTCGAACCGGCGGCGACGGCCTACGCCCAGGCGGTACTGACG
GCCCAGCAGGAGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006091 Acyl-CoA oxidase/dehydrogenase, central domain (Domain)
 [147-179]  8.09999999999999e-05 PF02770
PF02770   Acyl-CoA_dh_M
 [141-221]  1.5e-27 G3DSA:2.40.110.10
G3DSA:2.40.110.10   Acyl_CoA_DH/ox_M
IPR006092 Acyl-CoA dehydrogenase, N-terminal (Domain)
 [33-112]  2.3e-05 PF02771
PF02771   Acyl-CoA_dh_N
IPR009075 Acyl-CoA dehydrogenase/oxidase C-terminal (Domain)
 [222-403]  3.29999999999997e-35 G3DSA:1.20.140.10
G3DSA:1.20.140.10   AcylCoA_DH_1/2_C
 [257-384]  8.19999506482837e-10 SSF47203
SSF47203   AcylCoADH_C_like
IPR009100 Acyl-CoA dehydrogenase/oxidase (Domain)
 [33-231]  1.29999924468179e-31 SSF56645
SSF56645   AcylCoA_dehyd_NM
IPR013107 Acyl-CoA dehydrogenase, type 2, C-terminal (Domain)
 [257-386]  1.09999999999999e-34 PF08028
PF08028   Acyl-CoA_dh_2
IPR013786 Acyl-CoA dehydrogenase/oxidase, N-terminal (Domain)
 [22-136]  1.4e-30 G3DSA:1.10.540.10
G3DSA:1.10.540.10   AcylCoA_DH/ox_N
SignalP No significant hit
TMHMM No significant hit