close all open/close all
first first   Ncarz_00020 Ncarz_00020

CDS information : Ncarz_00010


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction10,097 / 10,894 / + [in whole cluster]
10,097 / 10,894 / + [in contig]
Location10097..10894 [in whole cluster]
10097..10894 [in contig]
TypeCDS
Length798 bp (265 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-hexose-4-ketoreductase
GenencsC4
Gene (GenBank)
EC number
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
O33708
NITE
Adria_00200
PmId
[9209071] Cloning and characterization of the Streptomyces peucetius dnmZUV genes encoding three enzymes required for biosynthesis of the daunorubicin precursor thymidine diphospho-L-daunosamine. (J Bacteriol. , 1997)
[10631513] A two-plasmid system for the glycosylation of polyketide antibiotics: bioconversion of epsilon-rhodomycinone to rhodomycin D. (Chem Biol. , 1999)
[9447597] Production of the antitumor drug epirubicin (4'-epidoxorubicin) and its precursor by a genetically engineered strain of Streptomyces peucetius. (Nat Biotechnol. , 1998)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-hexose-4-ketoreductase]
MPVDLASDSVGRLSESLAAAAPDALVNCVGATGGDPVRLAEVNARGPAVLCAPLLRARPT
ARLVHLGSAAEYGPQTDRVPASESAATRPVTVYGATKLAGTVTVSDSGLDALVLRVGNPV
GAGAPASGLPGRVCALLRKTGTGPDVVLRLGDLSAYRDFVDVRDVARAVERAVTAPGPLP
PVLNVGGGEAVLGRDLVHRLADTAGFRGRIEEQGTGSARSEHISWQCSDISAAAEVLGWQ
PTYSLARSLEALWSAGAHLEGDRPA
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-hexose-4-ketoreductase]
GTGCCCGTCGACCTGGCATCCGACTCCGTCGGCCGACTGTCCGAGAGTTTGGCCGCGGCA
GCGCCCGACGCCCTCGTCAACTGCGTCGGAGCGACTGGTGGCGACCCGGTGAGGCTCGCG
GAAGTCAACGCCCGCGGCCCGGCCGTGCTCTGTGCGCCGCTGCTCCGAGCCCGTCCCACC
GCCCGCCTGGTGCATCTGGGGTCAGCCGCCGAGTACGGCCCCCAAACGGACCGGGTCCCC
GCGTCGGAGTCGGCGGCCACCCGTCCGGTGACCGTCTACGGTGCCACGAAACTGGCCGGC
ACGGTGACGGTGTCCGACTCGGGGCTGGACGCACTGGTCCTGCGAGTCGGCAACCCGGTG
GGGGCCGGCGCACCGGCCTCGGGACTGCCCGGCCGAGTCTGCGCTCTTCTGCGGAAGACG
GGCACCGGCCCCGACGTGGTGCTGCGCCTGGGCGACTTGTCGGCGTACCGGGACTTCGTC
GACGTGCGCGACGTGGCCCGGGCAGTGGAGCGGGCGGTGACCGCCCCCGGACCACTGCCG
CCCGTGCTCAACGTAGGCGGCGGGGAGGCCGTCTTGGGGCGCGATCTGGTGCATCGGCTG
GCGGACACTGCCGGCTTCCGCGGGCGCATCGAGGAACAGGGCACCGGTTCCGCCCGGTCG
GAGCACATCTCCTGGCAGTGCTCGGACATCTCCGCCGCCGCCGAGGTCCTCGGCTGGCAG
CCCACGTACTCGCTCGCCCGTTCGCTGGAGGCGCTGTGGTCGGCCGGAGCGCACCTGGAA
GGCGACCGTCCGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [13-186]  1.9e-22 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [12-124]  1.99999999999999e-24 G3DSA:3.40.50.720 [163-202]  1.99999999999999e-24 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit
first first   Ncarz_00020 Ncarz_00020