close all open/close all

CDS information : Ncarz_00020


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction11,170 / 12,750 / + [in whole cluster]
11,170 / 12,750 / + [in contig]
Location11170..12750 [in whole cluster]
11170..12750 [in contig]
TypeCDS
Length1,581 bp (526 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative aminotransferase
Product (GenBank)aminotransferase
GenencsC3
Gene (GenBank)
EC number
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q8GMG0
NITE
C1027_00330
PmId
[12785829] A novel 4-methylideneimidazole-5-one-containing tyrosine aminomutase in enediyne antitumor antibiotic C-1027 biosynthesis. (J Am Chem Soc. , 2003)
[14580219] Kinetic analysis of the 4-methylideneimidazole-5-one-containing tyrosine aminomutase in enediyne antitumor antibiotic C-1027 biosynthesis. (Biochemistry. , 2003)

close this sectionSequence

selected fasta
>putative aminotransferase [aminotransferase]
MTTAETATGPVVVDGESLSVDALRQVAESGTPVKVHTEAMEKVLRSRASLESMIIRGEPV
PGAVGGDGRESPPGIDVARESERQTNLVRSHSVGVGPLYAEDEARAMVTARLNSLAKGHS
AVRPDILDRMVLYLNEGIIPAVPEIGSSGPVDLVPLAHVASTLIGEGHVLHDGRRQETRR
VLGAMGVAPLRLGVKEGTALINGTSGTVGLGALVVARALDQVRQAEIASAFFDDAVRGSD
SPFLAEGHDTARPHRGQIDSAANLRDLLADSRGRRETEHGGAVLGFPGPQVPGFYTARTV
PQVLGAARDALRHATEELEAELNSANDEPLFLPDGKVLHGGTAQGRAVALALEFVAIALS
HVGELAERQIDRMLTRRPASGVARYLVAADPTLHHGFAGVGHTARALTAENLAVGTAAAQ
VVTAFGDDRPTAGTGLLAARNARRVLQNNDRIIAIGLIVAAQAADLARRFDDLSRANMAT
YDMVRSLVPSLGVDRSMAQDVELIATALSRAEFLHLLLRQEGIVLR
selected fasta
>putative aminotransferase [aminotransferase]
GTGACCACAGCTGAGACCGCCACTGGTCCGGTCGTCGTCGACGGCGAGAGCCTCAGCGTC
GATGCCCTGCGTCAGGTCGCGGAGTCAGGGACCCCCGTGAAGGTCCACACCGAAGCGATG
GAGAAGGTACTCAGGAGCCGTGCCTCGCTGGAGAGCATGATCATTCGCGGCGAGCCCGTA
CCTGGTGCCGTCGGCGGTGACGGCCGTGAGAGCCCGCCAGGCATCGATGTGGCGCGGGAG
TCCGAACGGCAGACGAACCTGGTGCGCAGCCACAGCGTCGGCGTCGGGCCCCTGTACGCC
GAGGACGAGGCACGAGCCATGGTGACGGCGCGTCTGAACTCTCTGGCCAAAGGGCACTCG
GCCGTGCGACCGGACATACTCGACCGCATGGTGCTCTATCTGAACGAGGGGATAATCCCG
GCCGTGCCCGAGATCGGATCATCTGGTCCGGTTGATCTCGTTCCCCTCGCCCATGTGGCA
AGCACCCTGATCGGGGAAGGGCATGTTCTGCACGACGGCAGGCGCCAGGAGACCCGCAGG
GTCCTGGGCGCGATGGGAGTCGCACCGCTCCGGCTCGGTGTCAAGGAGGGCACTGCGCTG
ATCAATGGCACGTCGGGCACGGTCGGCCTGGGAGCGCTCGTGGTGGCACGAGCCCTTGAC
CAGGTGCGCCAGGCAGAGATCGCCTCGGCCTTCTTCGACGACGCGGTGCGAGGTTCCGAC
AGCCCGTTCCTGGCCGAAGGACATGACACGGCCCGTCCACATCGGGGGCAGATCGACTCG
GCCGCCAACTTGCGTGATCTGCTGGCGGACAGCCGGGGGCGGCGGGAAACGGAGCACGGG
GGTGCCGTGCTCGGGTTCCCGGGGCCGCAGGTACCCGGCTTCTACACGGCACGCACGGTG
CCGCAGGTGCTCGGCGCGGCCCGGGACGCCCTCCGGCACGCTACGGAGGAGCTGGAGGCA
GAACTCAACTCCGCGAACGACGAACCTCTCTTCTTACCGGACGGAAAAGTCCTCCACGGC
GGAACCGCCCAGGGGCGGGCCGTGGCGCTCGCCCTGGAGTTTGTCGCCATCGCGCTCAGC
CACGTCGGCGAGCTGGCCGAACGGCAGATCGACCGCATGCTCACCCGGCGTCCGGCCTCC
GGCGTTGCGCGGTACCTCGTGGCGGCGGATCCGACGCTGCACCATGGTTTCGCGGGCGTC
GGCCACACAGCGCGGGCCCTCACGGCGGAGAACCTGGCGGTCGGCACTGCCGCTGCTCAG
GTCGTTACCGCCTTCGGCGACGACCGGCCAACGGCCGGCACCGGGCTCCTGGCGGCCCGC
AACGCACGACGCGTGCTGCAGAACAATGATCGGATCATTGCCATTGGCCTCATCGTCGCA
GCTCAGGCCGCCGACCTCGCTCGGAGATTCGATGATCTGAGCCGGGCGAACATGGCCACG
TACGACATGGTGCGTTCCCTGGTCCCGTCCCTCGGCGTCGACCGTTCGATGGCGCAGGAC
GTCGAGTTGATCGCCACTGCCCTGTCCCGGGCAGAGTTCCTCCATCTGCTCCTGCGGCAG
GAGGGGATCGTTCTGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001106 Aromatic amino acid lyase (Family)
 [11-491]  1.39999999999997e-123 PF00221
PF00221   Lyase_aromatic
IPR008948 L-Aspartase-like (Domain)
 [1-517]  SSF48557
SSF48557   L-Aspartase-like
IPR024083 L-Aspartase-like, N-terminal (Domain)
 [4-203]  8.00000000000001e-53 G3DSA:1.10.275.10
G3DSA:1.10.275.10   G3DSA:1.10.275.10
SignalP No significant hit
TMHMM No significant hit