close all open/close all

CDS information : Ncarz_00040


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction13,500 / 14,543 / + [in whole cluster]
13,500 / 14,543 / + [in contig]
Location13500..14543 [in whole cluster]
13500..14543 [in contig]
TypeCDS
Length1,044 bp (347 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MKTVVRRLLRDSSRQVRHVDVVDPRTADGLVAAVYTQCERDFGVLAPPLALHSAAAAPLA
AGWLLLRETLLAGRDADRAVKEAVATTVSRANRCPYCVEVHQAKLDTLRLPAAKDVATEI
AEWVQAVERPRQPRRPAPDGLTAAQAAELFGVAVTFHYLNRMVSVFLGDSPVPEPVPGRM
RGVIMRVVAKSMAPAARVPLEPGTSLDLLPSARLPPELAWAEASPAVAGALARATAAVNG
AARWIPHRVREGLRRRLSEWDGEPVGPSRAWLDEATRRYPPAEAPLARLVLLTAFAPYQV
VEADVRSFRERHPLDRELIEVTSWSALTTAFHIGAGFPRFGRTAPVG
selected fasta
>hypothetical protein [unknown]
TTGAAAACCGTTGTCCGACGGTTGCTGAGGGACTCGTCACGGCAGGTGCGGCACGTCGAT
GTCGTGGACCCGCGTACGGCTGACGGCCTGGTCGCGGCCGTCTACACGCAGTGCGAGCGG
GATTTCGGCGTGCTGGCCCCGCCGCTTGCTCTGCACTCCGCGGCTGCCGCACCGCTTGCC
GCCGGCTGGCTGCTGCTGCGGGAGACGCTGCTCGCGGGCAGGGATGCGGACCGCGCCGTG
AAGGAAGCCGTCGCCACCACCGTTTCCCGGGCCAACCGGTGTCCCTACTGCGTCGAGGTC
CACCAGGCAAAGCTCGACACCCTGCGCCTGCCGGCGGCGAAGGACGTGGCCACGGAAATC
GCCGAATGGGTGCAGGCCGTCGAGAGGCCCAGGCAACCCAGGCGCCCGGCCCCCGACGGA
CTGACCGCGGCACAAGCCGCGGAACTCTTCGGTGTTGCGGTCACGTTCCACTATCTGAAC
CGCATGGTCAGCGTGTTCCTGGGTGACTCTCCCGTGCCTGAGCCCGTGCCCGGACGAATG
CGGGGGGTGATCATGCGTGTCGTCGCCAAGAGCATGGCTCCCGCTGCCCGTGTCCCTCTG
GAGCCCGGGACGTCGCTCGACCTCCTGCCCTCGGCCCGCCTGCCCCCCGAACTGGCGTGG
GCCGAAGCGAGTCCAGCAGTGGCAGGGGCCCTGGCCCGCGCGACAGCGGCCGTGAACGGC
GCGGCACGCTGGATCCCTCATCGGGTGCGCGAGGGGCTTCGCAGGCGTCTGTCCGAGTGG
GACGGGGAGCCTGTGGGACCCAGTCGCGCCTGGCTCGACGAAGCGACGCGGAGATACCCC
CCGGCGGAAGCTCCGCTCGCCCGGCTGGTCCTCCTGACGGCCTTCGCCCCGTACCAGGTC
GTGGAAGCCGATGTACGTTCCTTCCGCGAAAGGCATCCCCTCGACAGGGAACTGATCGAG
GTCACCTCCTGGTCGGCGTTGACCACCGCCTTCCATATCGGGGCCGGTTTCCCACGCTTC
GGCCGGACAGCTCCCGTCGGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003779 Carboxymuconolactone decarboxylase (Domain)
 [58-104]  2.2e-07 PF02627
PF02627   CMD
IPR004675 Alkylhydroperoxidase AhpD core (Domain)
 [77-106]  8.3e-08 TIGR00778
TIGR00778   AhpD_dom
SignalP No significant hit
TMHMM No significant hit