close all open/close all

CDS information : Ncarz_00050


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction14,674 / 15,672 / + [in whole cluster]
14,674 / 15,672 / + [in contig]
Location14674..15672 [in whole cluster]
14674..15672 [in contig]
TypeCDS
Length999 bp (332 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Product2,7-hydroxy-5-methyl-1-naphthoic acid C-7 O-methyltransferase
Product (GenBank)O-methyltransferase
GenencsB1
Gene (GenBank)
EC number2.1.1.-
Keyword
  • naphthoic acid
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[18387946] Regiospecific O-methylation of naphthoic acids catalyzed by NcsB1, an O-methyltransferase involved in the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin. (J Biol Chem. , 2008)
[19702337] Molecular basis of substrate promiscuity for the SAM-dependent O-methyltransferase NcsB1, involved in the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin. (Biochemistry. , 2009)
[20735485] In vivo characterization of NcsB3 to establish the complete biosynthesis of the naphthoic acid moiety of the neocarzinostatin chromophore. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>2,7-hydroxy-5-methyl-1-naphthoic acid C-7 O-methyltransferase [O-methyltransferase]
MGKRAAHIGLRALADLATPMAVRVAATLRVADHIAAGHRTAAEIASAAGAHADSLDRLLR
HLVAVGLFTRDGQGVYGLTEFGEQLRDDHAAGKRKWLDMNSAVGRGDLGFVELAHSIRTG
QPAYPVRYGTSFWEDLGSDPVLSASFDTLMSHHLELDYTGIAAKYDWAALGHVVDVGGGS
GGLLSALLTAHEDLSGTVLDLQGPASAAHRRFLDTGLSGRAQVVVGSFFDPLPAGAGGYV
LSAVLHDWDDLSAVAILRRCAEAAGSGGVVLVIEAVAGDEHAGTGMDLRMLTYFGGKERS
LAELGELAAQAGLAVRAAHPISYVSIVEMTAL
selected fasta
>2,7-hydroxy-5-methyl-1-naphthoic acid C-7 O-methyltransferase [O-methyltransferase]
GTGGGAAAAAGGGCTGCACACATCGGATTGAGGGCGCTGGCCGATCTGGCGACTCCCATG
GCGGTCCGCGTGGCGGCCACGCTGCGGGTCGCCGATCACATAGCGGCCGGACACCGCACC
GCCGCGGAGATCGCCTCCGCGGCCGGAGCACATGCGGATTCCCTGGACAGGTTGCTGCGC
CACCTGGTCGCCGTCGGTCTGTTCACCAGGGACGGCCAGGGCGTCTACGGTCTGACAGAG
TTTGGGGAGCAGCTGCGCGACGACCACGCTGCCGGAAAACGCAAGTGGCTGGACATGAAC
AGTGCCGTGGGGCGGGGCGACCTCGGTTTCGTCGAGTTGGCCCACAGCATTCGCACGGGG
CAGCCCGCGTACCCGGTGCGCTACGGAACGTCCTTCTGGGAGGACCTTGGCTCCGACCCC
GTTCTCTCGGCGTCCTTCGACACCCTGATGAGCCATCACCTGGAGCTGGACTACACCGGC
ATCGCAGCCAAGTACGACTGGGCTGCCCTCGGGCATGTCGTCGACGTGGGCGGCGGCAGC
GGCGGATTGCTCAGCGCACTGCTGACAGCCCACGAGGACCTGTCGGGAACCGTCCTCGAC
CTGCAAGGGCCGGCATCGGCCGCGCACCGCAGGTTTCTGGACACCGGGTTGTCCGGACGG
GCACAGGTGGTGGTGGGCAGCTTCTTCGACCCATTACCGGCCGGCGCGGGCGGCTACGTG
CTGTCTGCCGTCCTGCACGACTGGGACGACCTGTCCGCCGTGGCGATCCTGAGGCGGTGC
GCGGAGGCGGCCGGCAGCGGAGGCGTCGTGCTCGTCATCGAAGCGGTGGCCGGCGACGAG
CACGCCGGCACCGGCATGGATCTGCGCATGCTCACCTACTTCGGAGGCAAGGAACGCAGC
CTTGCCGAACTAGGCGAACTCGCCGCACAGGCCGGCCTCGCCGTACGCGCGGCCCACCCG
ATCAGCTACGTCTCGATAGTCGAAATGACCGCCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001077 O-methyltransferase, family 2 (Domain)
 [74-308]  2.29999999999998e-48 PF00891
PF00891   Methyltransf_2
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [10-82]  1.7e-16 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR016461 O-methyltransferase, caffeic acid-type (Family)
 [1-332]  6.29999562859499e-12 PIRSF005739
PIRSF005739   O-mtase
SignalP No significant hit
TMHMM No significant hit