close all open/close all

CDS information : Ncarz_00060


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction15,786 / 16,220 / + [in whole cluster]
15,786 / 16,220 / + [in contig]
Location15786..16220 [in whole cluster]
15786..16220 [in contig]
TypeCDS
Length435 bp (144 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MGVKMSSGPSVAAADRDVTAVADVPRRMMEAWASNDASAFASLFAPDGTMVLPGDVFQKG
VDGIREFMTKCYAGPYKGTSVFGVPIDVRFTGPDTAILITQGGVMAPGEHSVAPDKEIRA
TWVLGKRDGAWLVEAYHNSPVRLP
selected fasta
>hypothetical protein [unknown]
ATGGGAGTGAAGATGAGTTCTGGCCCTTCGGTAGCCGCGGCCGACCGGGACGTCACGGCT
GTGGCCGACGTCCCCCGGCGCATGATGGAGGCGTGGGCGTCCAACGACGCCTCCGCCTTC
GCGAGCCTCTTCGCCCCGGACGGGACCATGGTGCTTCCCGGCGACGTCTTCCAGAAGGGA
GTCGACGGGATTCGGGAGTTCATGACCAAGTGCTATGCCGGTCCGTACAAGGGCACCTCG
GTTTTCGGAGTGCCCATCGACGTAAGGTTCACCGGCCCCGACACGGCGATCCTGATCACT
CAGGGCGGAGTCATGGCTCCTGGGGAGCACTCGGTCGCCCCCGACAAGGAGATCCGGGCC
ACGTGGGTGCTCGGCAAGCGTGACGGTGCGTGGCTCGTCGAGGCCTACCACAACAGCCCC
GTCCGTCTGCCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011944 Steroid delta5-4-isomerase (Family)
 [17-142]  6.80000000000006e-48 TIGR02246
TIGR02246   TIGR02246
SignalP
 [1-12]  0.609 Signal
Bacteria, Gram-negative   
TMHMM No significant hit