close all open/close all

CDS information : Ncarz_00070


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction22,015 / 16,754 / - [in whole cluster]
22,015 / 16,754 / - [in contig]
Locationcomplement(16754..22015) [in whole cluster]
complement(16754..22015) [in contig]
TypeCDS
Length5,262 bp (1,753 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)iterative type I polyketide synthase
GenencsB
Gene (GenBank)
EC number
Keyword
  • iterative
  • naphthoic acid
Note
Note (GenBank)
Reference
ACC
PmId
[15147895] Neocarzinostatin naphthoate synthase: an unique iterative type I PKS from neocarzinostatin producer Streptomyces carzinostaticus. (FEBS Lett. , 2004)
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[25238086] Insights into the programmed ketoreduction of partially reducing polyketide synthases: stereo- and substrate-specificity of the ketoreductase domain. (Org Biomol Chem. , 2014)
Related Reference
ACC
P87162
PmId
[20304931] Hidden function of catalytic domain in 6-methylsalicylic acid synthase for product release. (J Biol Chem. , 2010)

close this sectionPKS/NRPS Module

B1 acetyl-CoA
malonyl-CoA
KS1..367
AT526..841
TH849..996
KR1378..1571
ACP1664..1733

close this sectionSequence

selected fasta
>polyketide synthase [iterative type I polyketide synthase]
MSCRYAPDLDSPDKFWDFLVNGRSTVGDMPDKRWEPYASGSPQATAAMRDTVRRGAFLDD
IEGFDAEFFGISPREADFLDPQQRFMLELAWEALADAGVPPLTLRNTDTGVYAAANSNDY
GRRLLEDIPRTGAYAVNGTTLYGIANRVSYFLDLHGPSMAVDTACAGALTALHLARQSLL
TGETPLAIVGGLNIMSTPSLNVALNDAGAMSPDGRSKAFDEDADGYGRGEGAGVLVLKRL
SDARRDNDPVHAVIRGSGVFQDGRSDGMMAPDGDAQEHMLRQAYHRAGVDPATVDYVEAH
GTGTPTGDREEITALAKVFGAGRSPHAPCLIGSVKPNVGHVEGGSGITGVIKTVLALRNE
LIPPTLHDRPRTDVDWDAWGVRLVGQVQEWPSCGRPRRAGVSSYGVGGTISHVILEESPV
PAATSSADASTGVRTPALFPLSAASEAGLRALAGEAAGWVASRPDTPLPSVGHTLTQRRS
HLAQRAAVVADSAEQLVDRLREVAEGRNGPGIVSARTSAGRADDAVWVFSGHGAQWSGMG
RRLLASEPVFAATLDALDEVFREELGWTPREAVTEGGPWTAAHVQALTFAVQIGLADVWR
SKGLRPGAVIGHSVGEIAAAVVAGSLDRDEAARFACRRAAALQRLDGRGAMVMVGLPFEE
AALRLGDRRDVEAAISAGPHSTVLSGDRSAVLRVAEEWQASEVWTRTVDSDIAFHSVHVD
EVTGDIESAARLLTPRPPTVPLYTTALSDPRSRAPRDSGYWAANLRKPVRFTEAVRAAAE
DGHRLFLEVSSHPVVAHSVSETLLDLGIEDAAVAGTLRRDTDEVESLLENLAELHCHGVA
VDWARHHTDGELVGLPAAVWQHRPYWIFPETTADAGLGRGHDPASHSLLGGRMTVSGSPT
RQVWQTRLDMDSRPYPQSHGLVGVEVTPAASIINTFAAAVEEDGPSALTDIVLRTPLAVE
PPRVVQVVREGRSLSLATRVAEDADADGSEWITHTTAAVTPGVRPAGGRLDTEAIRSRLP
EGSLTRADEMFERMGVEGYAFPWDLEELRHDDHEQLAVLQIEPSPAQRATSWAHVIDGAL
TISAMVVSPGDATVLWMSRSIDQVTWSGEPPARLTVHSTRSLRSPHDTVDVRVADERGDV
VCEVVGLRFAAVEHIGAAVLPSELVHEIVWRPWDPEDHEGAEDAPVEQVILVGDPEATVP
LAEQLESAGMTCVQVGDSPETGLRPDLFARPGAVVVAPALAGSDTAPEEEAERVSWLLVR
TVQRVAEIRADVTGDAPAQRVWCVTSDVRRARDERSVAHGPLWGLARIVAGDHPELWGGA
VDIGPSADGIGARLVALLDGAAGTEDVISLTGEGAEVARLSRIDRSADGTPLQCSPSGTV
LITGGLGALGLEVARWLVDRGARRLVLVSRRALPNRTEWPAVTDAETRRRIDGVLALEAL
GVTVRVLALDITDVDQVSAALAPEALGLPPVRGVVHAAGVVNNALVDKVDLEGLREVLAP
KVRGAMVLHRLFPPGDLDFFVLFSSCGQFARLSGQASYAAANSFLDTLASHRNAGEHTET
VSLGWTAWRGLGMSSNIDTTMFEANSRGLEAVSATEAFGAWSFGDRFQSDYQAILRVVPT
PVHTPRLPVFRDLPVSGETDGPTGDQLFTTTLEGLPEQEARERITADVREQVAGVLNFDP
SEVEVKRPLVELGVDSVMTVALRVRLQRRYGLELPPTILWAKPTVAALSEHVCDSLRWDG
EEHGDLAAPTAAA
selected fasta
>polyketide synthase [iterative type I polyketide synthase]
ATGAGTTGCAGGTATGCCCCGGATCTCGACTCGCCGGACAAGTTCTGGGACTTCCTTGTC
AACGGCAGAAGCACCGTCGGTGACATGCCTGACAAACGGTGGGAACCCTACGCATCGGGC
AGCCCGCAGGCGACCGCGGCGATGAGGGACACCGTTCGCCGCGGCGCGTTCCTCGATGAC
ATCGAAGGCTTCGACGCCGAGTTCTTCGGAATCTCGCCCAGGGAAGCCGACTTCCTGGAT
CCCCAGCAGCGCTTCATGCTCGAGCTCGCCTGGGAAGCCCTGGCCGACGCCGGTGTTCCC
CCGCTGACTCTGCGCAACACCGACACCGGCGTGTACGCCGCCGCGAATTCCAACGACTAC
GGCAGGCGGCTCCTGGAGGACATCCCGCGTACCGGTGCCTATGCGGTGAACGGCACGACG
CTGTACGGCATCGCCAACCGCGTCTCCTACTTCCTGGACCTCCACGGACCGAGCATGGCG
GTCGACACGGCCTGCGCCGGAGCGCTGACGGCTCTTCACCTCGCCCGTCAGAGCCTGCTG
ACCGGGGAAACGCCCCTGGCGATCGTCGGCGGTCTCAACATCATGTCCACTCCCTCCCTC
AACGTGGCCCTCAACGACGCCGGAGCCATGTCCCCCGACGGCCGCAGCAAGGCCTTCGAC
GAGGACGCCGACGGGTACGGCCGCGGTGAGGGGGCAGGGGTTCTCGTACTCAAGAGGCTG
TCCGACGCACGGCGCGACAACGATCCCGTCCACGCGGTCATTCGTGGCAGCGGTGTCTTC
CAGGACGGCCGTTCCGACGGCATGATGGCGCCGGACGGGGACGCCCAGGAGCACATGCTC
CGGCAGGCGTACCACCGGGCGGGGGTGGACCCGGCCACAGTGGACTACGTCGAGGCGCAC
GGCACGGGAACACCCACTGGTGACCGTGAGGAGATCACCGCCCTCGCCAAGGTGTTCGGA
GCAGGCCGGTCACCCCATGCCCCCTGCCTGATCGGATCGGTGAAGCCCAACGTCGGTCAC
GTCGAGGGCGGCTCCGGCATCACCGGCGTGATCAAGACGGTCCTCGCGCTGAGGAACGAG
CTGATCCCCCCCACCCTCCACGACCGGCCCCGTACCGACGTCGACTGGGACGCCTGGGGG
GTGCGCCTGGTCGGGCAGGTACAGGAGTGGCCCTCCTGCGGACGGCCCCGGCGCGCGGGA
GTCTCCAGCTACGGCGTCGGGGGCACGATCTCCCACGTGATCCTGGAGGAGAGCCCGGTG
CCGGCGGCGACCTCGTCCGCCGACGCCTCCACAGGCGTACGGACGCCCGCACTCTTCCCG
CTCTCGGCCGCCTCGGAGGCGGGACTGCGCGCGCTGGCGGGCGAGGCCGCAGGCTGGGTG
GCCTCTCGTCCTGACACCCCGCTGCCGTCGGTCGGACACACCCTGACTCAACGGCGCTCG
CACCTTGCTCAGCGTGCCGCGGTCGTCGCGGACTCCGCCGAGCAACTCGTCGACCGGCTG
CGCGAGGTCGCTGAGGGACGCAACGGCCCCGGCATCGTGTCGGCACGCACCAGTGCGGGG
CGCGCTGACGACGCCGTCTGGGTCTTCTCCGGGCATGGTGCCCAGTGGTCCGGAATGGGC
CGCCGACTGCTGGCGAGCGAGCCGGTCTTCGCGGCGACCCTCGACGCGCTGGACGAGGTG
TTCCGCGAGGAACTCGGCTGGACGCCCCGGGAGGCGGTCACGGAGGGCGGACCGTGGACT
GCCGCTCATGTCCAGGCACTGACCTTCGCCGTCCAGATCGGGCTGGCTGACGTGTGGCGC
AGCAAGGGCCTGCGGCCGGGCGCGGTCATCGGGCATTCCGTCGGTGAGATCGCGGCTGCG
GTGGTGGCCGGGTCCCTCGACCGTGATGAGGCCGCCCGTTTCGCGTGTCGCCGTGCGGCG
GCGCTCCAGAGGCTCGACGGGCGGGGCGCCATGGTCATGGTCGGGCTTCCGTTCGAGGAG
GCGGCCCTGCGCCTTGGAGACAGGCGGGACGTGGAGGCCGCCATCTCGGCGGGACCGCAT
TCCACGGTCCTGTCCGGTGACCGTTCGGCGGTTCTGCGCGTCGCCGAGGAGTGGCAGGCC
TCGGAGGTGTGGACGCGGACCGTCGACTCCGACATCGCTTTTCACAGCGTCCACGTCGAC
GAGGTGACTGGCGACATCGAGTCGGCCGCACGCCTGCTCACGCCCCGGCCGCCGACCGTC
CCCCTCTACACCACCGCCCTGTCCGACCCGCGGTCGCGGGCTCCGCGCGACAGCGGCTAC
TGGGCGGCGAACCTGCGCAAGCCGGTCCGCTTCACCGAGGCCGTACGCGCGGCCGCCGAG
GACGGCCACCGACTGTTCCTCGAGGTGTCCAGCCACCCGGTGGTGGCCCATTCGGTCAGC
GAGACGCTTTTGGACCTCGGCATCGAGGACGCCGCGGTGGCCGGGACACTGCGGCGCGAC
ACCGACGAGGTGGAGTCGCTGCTGGAAAACCTCGCCGAACTGCACTGCCACGGCGTGGCC
GTCGACTGGGCGCGCCATCACACCGACGGCGAGCTCGTGGGACTGCCGGCGGCCGTGTGG
CAGCACCGGCCCTACTGGATCTTCCCCGAGACCACCGCCGACGCGGGTCTCGGCCGTGGG
CACGATCCCGCGAGCCACAGCCTGCTCGGCGGCCGGATGACCGTCAGCGGCTCACCGACC
AGGCAGGTGTGGCAAACCCGGCTCGACATGGACAGCCGGCCCTACCCGCAGAGCCACGGG
CTCGTCGGTGTCGAGGTCACCCCCGCGGCGTCCATCATCAACACCTTCGCCGCAGCTGTG
GAGGAGGACGGTCCGTCCGCTTTGACGGACATCGTGCTGCGTACGCCCCTGGCGGTGGAA
CCGCCTCGGGTGGTCCAGGTGGTGCGCGAAGGAAGGTCGCTGTCGCTCGCCACCCGCGTG
GCCGAGGACGCCGACGCCGACGGGAGCGAGTGGATCACGCACACCACGGCCGCCGTCACG
CCGGGGGTCCGCCCGGCCGGCGGGCGGCTGGACACGGAAGCCATCCGCTCTCGGCTCCCG
GAGGGATCGCTCACCAGGGCCGACGAGATGTTCGAGCGCATGGGGGTCGAGGGCTACGCC
TTCCCGTGGGACCTGGAGGAGCTGCGCCACGACGACCATGAGCAGCTCGCCGTACTGCAG
ATCGAGCCCTCGCCGGCCCAGAGGGCGACCAGCTGGGCCCACGTCATCGACGGCGCGCTG
ACCATCAGCGCCATGGTGGTCTCCCCAGGGGACGCCACCGTGCTCTGGATGTCCCGGTCC
ATCGATCAGGTGACGTGGTCGGGTGAGCCGCCCGCCAGGCTCACCGTGCACAGCACCCGT
TCGCTCCGGTCACCGCACGACACGGTCGACGTGCGGGTCGCCGACGAACGGGGGGACGTC
GTCTGCGAGGTCGTCGGGCTCCGATTCGCGGCCGTCGAACACATCGGCGCCGCGGTATTG
CCCAGCGAACTGGTGCACGAGATCGTGTGGCGCCCCTGGGACCCGGAGGACCACGAGGGT
GCTGAGGATGCGCCCGTGGAGCAGGTGATCCTCGTCGGGGATCCCGAGGCCACCGTTCCT
CTCGCCGAACAACTCGAGTCGGCCGGCATGACCTGCGTACAGGTGGGCGACTCACCGGAG
ACGGGGCTGCGGCCCGACCTGTTCGCCCGGCCGGGCGCGGTGGTCGTTGCGCCCGCTCTG
GCCGGTTCGGACACGGCGCCGGAGGAGGAGGCGGAGCGCGTGTCGTGGCTGCTCGTACGG
ACCGTGCAACGTGTCGCCGAGATCCGGGCCGACGTCACCGGGGACGCACCGGCGCAGCGG
GTGTGGTGCGTCACCAGCGACGTCCGACGGGCCCGTGACGAACGGTCTGTGGCGCACGGG
CCGCTGTGGGGCCTGGCTCGCATCGTCGCGGGAGACCATCCCGAACTGTGGGGCGGGGCC
GTCGACATCGGGCCGTCGGCCGACGGCATCGGCGCGCGTCTGGTCGCACTGCTGGACGGT
GCCGCCGGTACGGAGGATGTCATCTCGCTGACGGGCGAGGGAGCCGAGGTCGCCCGGCTG
AGCCGCATCGACCGCAGTGCGGACGGTACGCCGCTGCAGTGTTCGCCCTCGGGCACCGTC
CTGATCACCGGCGGCCTGGGCGCTCTGGGACTGGAGGTCGCGAGGTGGCTGGTGGACCGG
GGCGCCCGTCGGCTCGTGCTCGTCAGCCGCCGTGCCCTGCCCAACCGTACCGAGTGGCCT
GCCGTCACCGACGCCGAGACCAGGCGCAGGATCGACGGCGTGCTGGCGCTCGAGGCACTC
GGCGTCACGGTCCGGGTGCTCGCGCTCGACATCACGGACGTCGACCAGGTGTCGGCGGCA
CTGGCGCCGGAAGCGCTCGGTCTGCCGCCGGTGCGGGGAGTCGTGCACGCTGCAGGTGTC
GTGAACAACGCCCTGGTGGACAAGGTCGACCTCGAGGGACTGCGAGAGGTGCTGGCCCCG
AAGGTCCGTGGCGCCATGGTGCTGCACCGCCTCTTCCCACCCGGTGATCTCGACTTCTTT
GTGTTGTTCTCCTCCTGCGGCCAGTTCGCCCGTCTGTCGGGCCAGGCCAGTTACGCCGCG
GCCAACTCGTTCCTGGACACGCTCGCGAGCCACCGCAACGCGGGAGAGCACACCGAGACG
GTCAGCCTGGGCTGGACGGCCTGGCGTGGGCTGGGCATGTCCTCGAACATCGACACCACG
ATGTTCGAGGCCAACTCGCGAGGCCTGGAAGCCGTCTCCGCGACCGAGGCGTTCGGCGCG
TGGTCCTTCGGCGACAGGTTCCAGTCCGACTACCAGGCCATACTCCGGGTGGTGCCGACC
CCCGTGCACACACCTCGCCTGCCGGTGTTCCGGGACCTGCCCGTCTCCGGCGAGACGGAC
GGCCCCACGGGCGACCAGCTCTTCACCACCACTCTGGAAGGGCTTCCGGAGCAGGAGGCA
CGCGAGAGGATCACCGCCGATGTGCGCGAACAGGTGGCCGGAGTGCTCAACTTCGACCCC
TCTGAAGTAGAGGTCAAGCGCCCCCTCGTCGAGCTCGGAGTCGACTCAGTGATGACGGTC
GCTCTCCGGGTGCGCCTGCAGCGTCGGTACGGCCTCGAGCTTCCGCCGACGATTTTGTGG
GCCAAGCCGACTGTGGCGGCCCTCTCCGAACATGTCTGCGACAGCCTGCGTTGGGACGGG
GAGGAGCACGGGGATCTGGCTGCGCCGACCGCGGCGGCGTAG
[1] KS1..367
[1] AT526..841
[1] acetyl-CoA malonyl-CoA712..716
[1] TH849..996
[1] KR1378..1571
[1] ACP1664..1733
[1] KS1..1101
[1] AT1576..2523
[1] acetyl-CoA malonyl-CoA2134..2148
[1] TH2545..2988
[1] KR4132..4713
[1] ACP4990..5199

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [514-645]  5.79999999999997e-62 G3DSA:3.40.366.10 [712-830]  5.79999999999997e-62 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1378-1554]  4.70000000000003e-53 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1691-1706]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1661-1735]  7.79999999999999e-18 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1664-1733]  PS50075
PS50075   ACP_DOMAIN
 [1655-1740]  5.00000909915354e-19 SSF47336
SSF47336   ACP_like
 [1667-1732]  1.1e-13 PF00550
PF00550   PP-binding
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1-243]  2.20000000000002e-76 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [251-367]  7.10000000000008e-43 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [526-841]  3.10000000000005e-91 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [524-821]  9.19998414420354e-56 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [647-711]  3.89999861795218e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [1-255]  1.60000000000002e-82 G3DSA:3.40.47.10 [256-419]  1.6e-56 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1-417]  2.7000136937899e-90 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1379-1586]  5.00000000000001e-30 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [528-821]  4.89996723796399e-87 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1665-1736]  1.20000117458134e-20 SM00823
SM00823   PKS_PP
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1378-1571]  1.10000150671643e-50 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit