close all open/close all

CDS information : Ncarz_00080


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction22,479 / 24,155 / + [in whole cluster]
22,479 / 24,155 / + [in contig]
Location22479..24155 [in whole cluster]
22479..24155 [in contig]
TypeCDS
Length1,677 bp (558 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Product2-hydroxy-7-methoxy-5-methyl-1-naphthoic acid--CoA ligase
2-hydroxy-7-methoxy-5-methyl-1-naphthoyl-CoA synthetase
Product (GenBank)adenylate ligase
GenencsB2
Gene (GenBank)
EC number6.2.1.-
Keyword
  • naphthoic acid
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[17539640] Characterization of NcsB2 as a promiscuous naphthoic acid/coenzyme A ligase integral to the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>2-hydroxy-7-methoxy-5-methyl-1-naphthoic acid--CoA ligase [adenylate ligase]
MHETAAAPAPAGFVPWPDDVAARYTAAGHWEGRSLGTHLAEAARKVPEAVCLVDGPVRMS
YSELMARADGAAVRMRGLGIRPADRVVVQLPNCWEHVVVTMACLRLGALPIWALPQYRHR
ELSGVVTHARASALVVPDVYREFDHQALAHEVAEAQPTVRHVLVAGSDVRPDSVDLRALC
EPLDADEAARVAAELDRSAPRGEEVAMLKLSGGTTGLPKLVARTHNDLSYMIKRAAQVCG
FGRDTVYLAVLPLGHGFPNTGPGVLGTLLAGGRVVISGSPAPEAAFALMERERVTATSVV
PAIVMRWLQYRDERPGADLGSLELMQVGASRLEPEVARQVGPKLGCRLQQVFGMAEGLLC
LTRLDDPDDVVHYTQGRPISPDDEIRVVDPEGRTVGVGEPGALLTRGPYTPRGYYDSPSA
NARAFTPDGWYRTGDLVRRTPDGNLIVVGREKDLINRGGEKINAEEVEGFAVQVDGVLQA
AAVGLPDSELGERICLFVVLADGTRVELADVRKVMENAETASFKLPERLITLPSLPTTPM
GKIDKKALRAAAGRMSET
selected fasta
>2-hydroxy-7-methoxy-5-methyl-1-naphthoic acid--CoA ligase [adenylate ligase]
ATGCACGAGACAGCAGCAGCACCGGCCCCCGCAGGATTCGTCCCCTGGCCCGACGATGTG
GCAGCCCGCTATACGGCCGCCGGCCACTGGGAGGGACGCTCGCTGGGGACGCACCTGGCG
GAGGCCGCACGGAAGGTCCCAGAGGCCGTATGCCTCGTCGACGGTCCGGTCCGTATGAGC
TACAGCGAGTTGATGGCACGCGCGGACGGGGCGGCCGTCCGTATGAGAGGGCTCGGCATT
CGCCCGGCCGACCGGGTGGTGGTGCAGCTACCCAACTGCTGGGAGCACGTGGTCGTGACC
ATGGCGTGCCTGCGGCTCGGCGCTCTGCCGATCTGGGCGCTGCCGCAGTACCGGCACCGC
GAACTGTCGGGCGTGGTGACTCACGCCCGGGCCAGTGCCCTCGTCGTGCCCGACGTGTAC
CGGGAGTTCGACCACCAGGCGCTGGCGCACGAAGTGGCGGAGGCGCAGCCGACTGTCCGG
CACGTCCTCGTGGCGGGGTCCGACGTACGGCCGGACAGCGTCGATCTGCGCGCGCTGTGC
GAGCCTCTGGACGCGGACGAGGCCGCGCGGGTCGCGGCCGAGCTCGACCGGTCCGCGCCG
CGTGGTGAGGAGGTCGCGATGCTCAAGCTGTCCGGCGGGACGACCGGACTGCCCAAGCTC
GTGGCACGCACGCACAACGACCTCAGCTACATGATCAAGCGCGCTGCCCAGGTGTGCGGC
TTCGGACGGGACACGGTGTACTTGGCCGTCCTGCCGCTCGGTCACGGCTTCCCCAACACC
GGTCCCGGAGTCCTCGGCACGCTCCTGGCCGGGGGGCGGGTGGTGATTTCCGGATCGCCG
GCTCCCGAGGCCGCTTTCGCGCTGATGGAGCGGGAACGGGTGACCGCCACGTCCGTGGTG
CCGGCCATTGTCATGCGGTGGCTCCAGTACCGGGACGAGCGGCCGGGCGCCGACCTGGGT
TCGCTGGAGCTCATGCAGGTCGGGGCCTCGCGGCTCGAGCCGGAGGTGGCCCGGCAGGTG
GGACCGAAACTGGGCTGCAGGCTGCAGCAGGTGTTCGGGATGGCGGAGGGCCTGCTGTGC
CTGACCCGCCTGGACGATCCGGACGACGTGGTCCACTACACCCAGGGACGGCCGATCAGC
CCGGACGACGAGATCCGGGTGGTGGACCCGGAGGGCAGGACAGTGGGTGTGGGCGAACCC
GGGGCGTTGCTCACGCGGGGGCCGTACACGCCGCGCGGCTACTACGATTCGCCCTCCGCC
AACGCGCGAGCGTTCACCCCCGACGGCTGGTACCGGACCGGTGACCTGGTACGCCGGACG
CCGGACGGCAACCTGATCGTGGTCGGCAGGGAGAAGGACCTCATCAACAGGGGTGGCGAG
AAGATCAACGCCGAGGAGGTGGAGGGCTTCGCGGTGCAGGTCGACGGAGTTCTGCAGGCG
GCTGCCGTCGGCCTGCCGGACAGCGAACTCGGCGAGCGGATCTGTCTGTTCGTCGTGCTG
GCCGACGGCACGCGGGTGGAGCTGGCGGACGTCCGGAAGGTGATGGAGAACGCCGAGACG
GCGTCGTTCAAGCTTCCGGAGCGTCTCATCACGCTTCCCTCCCTGCCCACCACACCGATG
GGCAAGATCGACAAGAAGGCACTGCGTGCTGCCGCCGGTCGGATGTCCGAAACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [60-481]  9.60000000000004e-89 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [208-219]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit