close all open/close all

CDS information : Ncarz_00100


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction27,188 / 26,475 / - [in whole cluster]
27,188 / 26,475 / - [in contig]
Locationcomplement(26475..27188) [in whole cluster]
complement(26475..27188) [in contig]
TypeCDS
Length714 bp (237 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative nucleotidyltransferase
Product (GenBank)NDP-hexose synthetase
GenencsC
Gene (GenBank)
EC number2.7.7.-
Keyword
  • deoxy aminosugar
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Family/Domain
FD
IPR005835

close this sectionSequence

selected fasta
>putative nucleotidyltransferase [NDP-hexose synthetase]
MHAVILAGGKGTRLRPYTSRLPKPLVPIGDEFSILEIVLSQLSQRGFDTVTLAIGYLGHL
IRSFVGDGSRWNMHITYASEDTPRGTIGPVLGILDQLPEHFLVMNGDILTDLDYADVLAH
HTRGEAPLTVATCTREVRIDFGVLTTTSNRVVHFVEKPTVDYRVSMGVYGLSRTTLETYP
SHMPFGFDDLVLDLLARGVQPAEYPFDGYWLDIGRPDDYDRANAEFDSIKGTLLKGA
selected fasta
>putative nucleotidyltransferase [NDP-hexose synthetase]
ATGCACGCAGTGATCCTGGCGGGCGGCAAGGGGACGAGGCTGCGGCCGTACACCAGCCGG
CTGCCCAAACCCCTGGTGCCGATCGGTGACGAGTTCTCGATCCTGGAGATCGTCCTGAGC
CAGCTCTCCCAGCGGGGATTCGACACGGTGACGCTCGCCATCGGCTACCTCGGCCACCTG
ATCCGTTCCTTCGTGGGCGACGGCAGCCGATGGAACATGCACATCACCTACGCCTCGGAG
GACACGCCCCGGGGGACGATCGGCCCGGTCCTGGGCATCCTCGACCAACTGCCCGAACAC
TTCCTGGTCATGAACGGTGACATCCTCACCGACCTGGACTACGCCGATGTGCTGGCCCAT
CACACCAGGGGTGAGGCGCCGCTGACGGTGGCGACGTGCACGCGCGAGGTGCGTATCGAC
TTCGGCGTGCTGACGACGACCAGCAACCGGGTGGTCCACTTCGTGGAGAAGCCGACGGTC
GACTACCGGGTCAGCATGGGGGTCTACGGCCTGAGCCGCACCACCCTCGAAACCTATCCG
TCCCACATGCCGTTCGGCTTCGACGACCTGGTCCTCGACCTGCTGGCCCGCGGTGTCCAG
CCGGCGGAGTACCCCTTCGACGGGTACTGGCTGGACATCGGCCGCCCTGACGACTACGAC
CGCGCCAACGCCGAGTTCGACTCGATCAAGGGGACCCTGCTCAAGGGGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [3-225]  5e-36 PF00483
PF00483   NTP_transferase
SignalP No significant hit
TMHMM No significant hit