close all open/close all

CDS information : Ncarz_00110


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction28,198 / 27,203 / - [in whole cluster]
28,198 / 27,203 / - [in contig]
Locationcomplement(27203..28198) [in whole cluster]
complement(27203..28198) [in contig]
TypeCDS
Length996 bp (331 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 4,6-dehydratase
Product (GenBank)NDP-hexose-4,6-dehydratase
GenencsC1
Gene (GenBank)
EC number
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
Q54116
PmId
[7883182] Cloning of the genes encoding thymidine diphosphoglucose 4,6-dehydratase and thymidine diphospho-4-keto-6-deoxyglucose 3,5-epimerase from the erythromycin-producing Saccharopolyspora erythraea. (Gene. , 1995)

close this sectionSequence

selected fasta
>putative NDP-hexose 4,6-dehydratase [NDP-hexose-4,6-dehydratase]
MAGLVAVTGAEGFIGSHLVETLVRRGHRVRAMVQYNSFASWGWLDRLDAEVMSHVEVFPG
DVRDPASVLELVEPASVVYHLAALIAIPYSYQAPRSYLDTNVMGTMNVLEAVRATGTPRL
VHTSTSETYGSARTVPIGEDHPLQAQSPYAATKVAADKLVESYHLSYGVPAVTLRPFNTF
GPRQSARAVIPTIISQLVAGARQITLGSLAPTRDFTYVTDTAEAFVSVGTAPASAVIGEV
FNAGTGTEVSIGRLAADIMRLMDADASIREDPQRLRPKDSEVLRLVCDAGSLRARTGWRP
RTDREDGLRRTIEWFRNPVNQAGYRQTHYNR
selected fasta
>putative NDP-hexose 4,6-dehydratase [NDP-hexose-4,6-dehydratase]
ATGGCCGGACTCGTAGCGGTCACTGGGGCGGAGGGATTCATCGGGTCACACCTGGTCGAG
ACGCTGGTGCGGCGGGGACACCGGGTGCGGGCCATGGTCCAGTACAACTCCTTCGCCTCA
TGGGGGTGGCTCGACCGGCTCGACGCCGAGGTGATGAGCCACGTGGAGGTGTTCCCCGGC
GACGTCCGTGACCCGGCGTCCGTACTGGAGCTGGTCGAGCCGGCCTCGGTCGTCTACCAC
CTGGCGGCGCTGATCGCGATTCCGTACTCCTACCAGGCGCCGCGTTCATACCTGGACACC
AATGTCATGGGCACGATGAATGTGCTGGAAGCTGTACGTGCCACCGGGACACCCAGGCTG
GTCCACACCTCGACGAGCGAGACGTACGGCTCGGCGAGGACGGTGCCGATCGGGGAGGAC
CATCCTCTGCAGGCCCAGTCCCCCTACGCGGCGACGAAGGTGGCTGCAGACAAGCTCGTC
GAGTCCTACCACCTCAGCTACGGTGTGCCCGCGGTGACCCTGCGGCCGTTCAACACGTTC
GGCCCCCGTCAGTCGGCCCGCGCGGTCATACCCACGATCATCAGCCAGCTTGTCGCAGGG
GCCCGGCAGATCACCCTCGGCTCTCTGGCGCCCACCCGTGACTTCACCTATGTCACCGAC
ACAGCGGAGGCCTTCGTCTCGGTCGGCACCGCTCCGGCGTCGGCAGTGATCGGGGAGGTC
TTCAACGCCGGCACGGGCACGGAAGTGTCCATCGGACGACTCGCCGCGGACATCATGCGG
CTGATGGATGCCGACGCGTCGATCAGGGAGGATCCACAGCGTCTGCGTCCCAAAGACTCC
GAGGTCCTACGCCTGGTCTGCGACGCCGGGAGTCTGCGCGCGCGCACGGGATGGCGTCCC
CGGACGGACCGCGAGGACGGCCTGCGCCGGACCATCGAATGGTTCCGCAATCCCGTGAAC
CAGGCCGGCTACAGGCAGACCCACTACAACCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [5-244]  1.70000000000001e-58 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [5-191]  7.29999999999998e-59 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit