close all open/close all

CDS information : Ncarz_00120


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction29,060 / 28,341 / - [in whole cluster]
29,060 / 28,341 / - [in contig]
Locationcomplement(28341..29060) [in whole cluster]
complement(28341..29060) [in contig]
TypeCDS
Length720 bp (239 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative methyltransferase
Product (GenBank)N-methyltransferase
GenencsC5
Gene (GenBank)
EC number2.1.1.-
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Family/Domain
FD
IPR013216

close this sectionSequence

selected fasta
>putative methyltransferase [N-methyltransferase]
MSAWLEEWNSRQDVYIGDRHRDRHFRAVAGDIVRLLPQGARRVLDYGPGDALSATRIAAA
CEEVVLCEAAETIRARISDRFANDPAIRVISPGQLADLAAGSVDLVVVHSVVQYLDADEL
DALLREVHRLLGADGLLVVGDLVPPGTGLVSDTAELLRFALREGFLGEAVPALVRLAFSP
YARRRRRLGLTRIDEAEMTARARRAGLSGHRVRPNIGNNQRRWTFVARRAAASSVRPSR
selected fasta
>putative methyltransferase [N-methyltransferase]
ATGTCCGCCTGGCTCGAGGAATGGAACAGCAGGCAGGACGTCTACATCGGCGACCGGCAC
CGGGACCGGCACTTCCGTGCGGTGGCAGGCGACATCGTCCGTCTGCTCCCGCAAGGAGCA
AGACGTGTGCTCGACTACGGCCCCGGAGACGCCTTGTCCGCCACGCGCATCGCCGCGGCC
TGTGAGGAAGTAGTCCTCTGCGAAGCCGCGGAGACGATCCGGGCCCGGATCTCGGACCGG
TTCGCGAACGATCCGGCAATCCGTGTCATCTCGCCGGGGCAGCTCGCGGACCTGGCCGCC
GGGTCGGTCGACCTGGTGGTCGTGCACTCGGTGGTGCAGTATCTCGACGCGGACGAACTG
GATGCCCTTCTCCGGGAGGTACACCGGCTTCTGGGCGCCGACGGGCTGCTCGTCGTCGGA
GACCTCGTCCCCCCGGGAACGGGGCTGGTGTCAGACACGGCCGAGCTGCTGCGCTTCGCC
CTGCGCGAGGGTTTCCTCGGGGAGGCGGTGCCGGCCCTCGTGCGGCTGGCGTTCTCCCCC
TATGCGCGTCGTCGTCGGCGGCTCGGCCTCACCCGGATCGACGAGGCCGAGATGACGGCC
CGAGCGCGGCGGGCTGGCCTCTCCGGTCACCGGGTTCGGCCCAACATCGGCAACAACCAG
CGACGTTGGACCTTCGTGGCCAGACGTGCGGCTGCGTCGTCCGTGCGACCGAGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [44-139]  3.2e-07 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit