close all open/close all

CDS information : Ncarz_00130


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction29,285 / 30,493 / + [in whole cluster]
29,285 / 30,493 / + [in contig]
Location29285..30493 [in whole cluster]
29285..30493 [in contig]
TypeCDS
Length1,209 bp (402 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyltransferase
GenencsC6
Gene (GenBank)
EC number
Keyword
  • deoxy aminosugar
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
A4VB68
PmId
[17996897] Haloferax volcanii AglB and AglD are involved in N-glycosylation of the S-layer glycoprotein and proper assembly of the surface layer. (J Mol Biol. , 2007)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyltransferase]
MTATAEESAELTRVSLTEIVIPVRNEEKALARNVHRLRDYLVRNFPYPFVITIAESGSAD
RTREIGEELARQLAEVRFVSFDSRGRGLALRHVWGTSRADVVSYMDADLSIDLDGFLPLI
APLASGHSDFAIGTRHARGSSVQRSLLRATLSRTYNLILRVVLGVRFSDAQCGFKAGRRE
VVQAILPTVQDDKWFFDTELLCAVQRQGLRIHEVPVDCLDDPDTTVAIGRTVVDMLRGVA
RVTGRRMRGAFGTPLPSHLQRLGVPVAPARRFLRFAMVGTASGLLHVLFYLLFTTVMPTL
AANALGLFLATVLNTAANRRITFGVRGRQDVLRHQAKGFVAFLLGLACTSTALLAAGPGS
GRTVELTVLLAGDVLASLVRFALLRHWVFRPSRGRDDKEADR
selected fasta
>putative glycosyltransferase [glycosyltransferase]
ATGACCGCGACCGCCGAAGAGTCCGCCGAACTGACGCGAGTGTCCCTGACCGAGATCGTG
ATTCCGGTGCGCAACGAGGAGAAGGCGCTCGCACGGAACGTGCACCGGCTGCGTGACTAT
CTCGTCCGGAACTTCCCGTATCCCTTCGTGATCACCATTGCGGAGAGCGGCAGCGCCGAC
AGGACACGCGAGATCGGCGAGGAGCTGGCCCGTCAGCTCGCCGAGGTGCGGTTCGTGAGC
TTCGATTCGAGGGGCCGGGGCCTGGCGCTCAGGCACGTGTGGGGAACGAGCCGGGCAGAC
GTGGTCAGCTACATGGACGCCGACCTCTCCATCGACCTGGACGGGTTCCTCCCGCTCATC
GCGCCGCTCGCATCGGGCCACAGCGACTTCGCCATCGGCACGCGGCACGCACGCGGGTCG
AGCGTGCAGCGGTCACTGCTGCGCGCCACGCTCTCCCGCACGTACAACCTGATCCTGCGC
GTAGTGCTGGGAGTGCGCTTCTCCGACGCCCAGTGCGGTTTCAAGGCCGGCCGGCGGGAG
GTCGTGCAGGCCATACTGCCGACCGTCCAGGACGACAAGTGGTTCTTCGACACGGAACTG
CTCTGTGCGGTGCAGCGCCAAGGGCTGCGCATCCACGAGGTCCCGGTCGACTGCCTTGAC
GACCCCGACACCACGGTCGCCATCGGCCGTACCGTCGTGGACATGCTCCGGGGTGTGGCC
CGTGTGACGGGCCGCCGGATGAGAGGTGCTTTCGGGACGCCCCTGCCGTCACACCTGCAG
CGCCTGGGAGTTCCCGTCGCCCCGGCACGCAGATTCTTGCGCTTCGCCATGGTCGGAACG
GCAAGCGGACTCCTGCACGTTCTGTTCTACCTGCTGTTCACCACGGTGATGCCCACGTTG
GCGGCGAACGCGCTCGGTCTCTTCCTCGCCACCGTCCTCAACACCGCAGCGAACCGCCGA
ATCACCTTCGGAGTACGAGGGCGCCAGGACGTACTGCGCCATCAGGCCAAGGGTTTCGTC
GCCTTCCTGCTCGGTCTGGCCTGCACCAGCACGGCACTGCTCGCGGCCGGTCCGGGAAGC
GGCAGGACCGTCGAACTGACGGTTCTGCTCGCCGGAGACGTTCTTGCCTCCCTTGTGAGG
TTCGCCCTCCTGCGGCACTGGGTGTTCCGCCCCTCCCGGGGCCGGGACGACAAGGAGGCG
GACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001173 Glycosyl transferase, family 2 (Domain)
 [19-184]  3.1e-16 PF00535
PF00535   Glycos_transf_2
IPR007267 GtrA-like protein (Domain)
 [274-389]  2.1e-11 PF04138
PF04138   GtrA
SignalP
 [1-31]  0.083 Signal
Eukaryota   
TMHMM
 [272-294]  Transmembrane (i-o) [298-317]  Transmembrane (o-i) [338-357]  Transmembrane (i-o) [367-389]  Transmembrane (o-i)
Transmembrane 4