close all open/close all

CDS information : Ncarz_00150


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction31,918 / 31,475 / - [in whole cluster]
31,918 / 31,475 / - [in contig]
Locationcomplement(31475..31918) [in whole cluster]
complement(31475..31918) [in contig]
TypeCDS
Length444 bp (147 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productneocarzinostatin apoprotein
Product (GenBank)neocarzinostatin apoprotein
GenencsA
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
Related Reference
ACC
P0A3R9
PmId
[39562] Neocarzinostatin: spectral characterization and separation of a non-protein chromophore. (Biochem Biophys Res Commun. , 1979)
[6448635] Stabilization of neocarzinostatin nonprotein chromophore activity by interaction with apoprotein and with HeLa cells. (Biochemistry. , 1980)
[6445563] Roles of chromophore and apo-protein in neocarzinostatin action. (Proc Natl Acad Sci U S A. , 1980)
[2967272] An antitumor polypeptide antibiotic neocarzinostatin: the mode of apo-protein--chromophore interaction. (J Antibiot (Tokyo). , 1988)
ACC
Q06110
PmId
[19845765] Disruption of cagA, the apoprotein gene of chromoprotein antibiotic C-1027, eliminates holo-antibiotic production, but not the cytotoxic chromophore. (FEMS Microbiol Lett. , 2009)

close this sectionSequence

selected fasta
>neocarzinostatin apoprotein [neocarzinostatin apoprotein]
MVPISIIRNRVAKVAVGSAAVLGLAVGFQTPAVAAAPTATVTPSSGLSDGTVVKVAGAGL
QAGTAYDVGQCAWVDTGVLACNPADFSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTV
DCTTAACQVGLSDAAGNGPEGVAISFN
selected fasta
>neocarzinostatin apoprotein [neocarzinostatin apoprotein]
GTGGTCCCCATTTCCATCATCAGGAATCGAGTAGCGAAGGTCGCCGTCGGCTCGGCGGCG
GTGCTGGGGCTCGCCGTAGGGTTCCAGACCCCGGCCGTGGCCGCGGCGCCGACGGCTACG
GTGACTCCGTCGTCCGGTCTGTCCGACGGCACCGTGGTCAAGGTCGCCGGCGCGGGTCTC
CAGGCCGGAACGGCCTACGACGTCGGGCAGTGCGCGTGGGTGGACACCGGTGTTCTCGCG
TGCAACCCGGCGGACTTCTCCTCCGTGACCGCGGACGCCAACGGCTCCGCGAGCACGTCG
CTGACGGTGCGCCGCTCCTTCGAGGGCTTCCTCTTCGACGGCACCCGCTGGGGCACCGTG
GACTGCACCACCGCGGCCTGCCAGGTCGGCCTCTCGGACGCTGCGGGCAACGGCCCGGAG
GGTGTGGCGATCTCCTTCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002186 Neocarzinostatin-type antitumour, antibiotic chromoprotein (Family)
 [38-147]  1.4e-49 PF00960
PF00960   Neocarzinostat
 [36-55]  1.8e-35 PR01885 [59-74]  1.8e-35 PR01885 [90-107]  1.8e-35 PR01885 [114-130]  1.8e-35 PR01885
PR01885   MACROMOMYCIN
 [44-147]  7e-53 PD012709
PD012709   NCZS_STRML_P0A3S0;
 [35-147]  2.2e-53 G3DSA:2.60.40.230
G3DSA:2.60.40.230   no description
 [35-147]  4e-51 SSF49319
SSF49319   Actinoxanthin-like
SignalP
 [1-35]  1 Signal
Bacteria, Gram-positive   
 [1-35]  0.986 Signal
Eukaryota   
 [1-34]  1 Signal
Bacteria, Gram-negative   
TMHMM No significant hit