close all open/close all

CDS information : Ncarz_00160


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction32,765 / 33,922 / + [in whole cluster]
32,765 / 33,922 / + [in contig]
Location32765..33922 [in whole cluster]
32765..33922 [in contig]
TypeCDS
Length1,158 bp (385 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productepoxide hydrolase
Product (GenBank)epoxide hydrolase
GenencsF1
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[20704329] Characterization of the epoxide hydrolase NcsF2 from the neocarzinostatin biosynthetic gene cluster. (Org Lett. , 2010)

close this sectionSequence

selected fasta
>epoxide hydrolase [epoxide hydrolase]
MRPFQVQIPQADIDDLKRRLSETRWPELVDVGWSRGAPLSYIKELAEYWRDGFDWRAAER
RINQYPQFTTEIDGATIHFLHVRSPEPDATPMVITHGWPGTPVEFLDIIGPLTDPRAHGG
DPADAFHLVIPSLPGFGLSGPLKSAGWELGRIAMAWSKLMASLGYERYIAQGGDIGAFTS
LLLGAIDPSHLAGIHVNLLQTNLSGEPGELETLSDADKARLAVSERFLDDLSGPMKMQST
RPHTIGYMLNDSPVAQLAYLLEMFKHWAQTENVPEDAVDRDLMLTHISLFWFTATGGSAA
QAHYELKPFLPITSLIGRSPTLDVPMGVAVYPGALFQPVRSLAERDFKQIVHWAELDRGG
HFSAMEEPDLFVDDLRTFNRTLKKL
selected fasta
>epoxide hydrolase [epoxide hydrolase]
ATGCGGCCGTTTCAGGTCCAGATCCCCCAGGCCGACATCGACGACCTCAAGCGCCGGCTG
AGCGAGACCCGCTGGCCCGAGCTCGTCGACGTCGGCTGGTCCCGTGGCGCCCCGCTGTCG
TACATCAAGGAGCTGGCCGAGTACTGGCGGGACGGCTTCGACTGGCGCGCCGCCGAACGC
CGCATCAACCAGTACCCGCAGTTCACCACGGAGATCGACGGGGCCACCATCCACTTCCTG
CACGTCCGCTCGCCCGAGCCGGACGCCACGCCGATGGTGATCACGCACGGCTGGCCCGGC
ACGCCGGTGGAGTTCCTGGACATCATCGGCCCGTTGACCGACCCGCGGGCCCACGGCGGC
GACCCCGCCGACGCGTTCCACCTGGTCATCCCCTCGCTGCCGGGCTTCGGCCTGTCCGGT
CCGCTCAAGAGCGCCGGATGGGAGCTGGGGCGGATAGCCATGGCCTGGTCCAAGCTGATG
GCTAGCCTCGGCTACGAGCGCTACATCGCCCAGGGCGGTGACATCGGCGCCTTCACCTCC
CTGCTGCTGGGCGCGATCGACCCCAGCCACCTGGCCGGCATCCACGTCAACCTCCTGCAG
ACCAACCTGAGCGGGGAACCCGGTGAGCTGGAGACCTTGAGCGATGCGGACAAGGCCCGC
CTCGCCGTTTCCGAGCGCTTCCTCGACGACCTGTCCGGTCCCATGAAGATGCAGTCGACC
CGGCCGCACACCATCGGCTACATGCTGAATGACTCGCCGGTCGCGCAGCTGGCGTATCTG
CTCGAGATGTTCAAGCACTGGGCTCAGACCGAGAACGTCCCCGAGGACGCGGTCGACCGG
GACCTGATGCTGACCCACATCTCGCTCTTCTGGTTCACCGCGACCGGCGGTTCCGCGGCA
CAGGCGCACTACGAGCTGAAGCCGTTCCTTCCGATCACCAGCCTGATCGGCCGGTCCCCG
ACCCTCGACGTCCCCATGGGCGTCGCGGTCTACCCCGGGGCGCTCTTCCAGCCGGTCCGC
AGCCTGGCCGAGCGTGACTTCAAGCAGATCGTGCACTGGGCGGAGCTCGACCGCGGCGGT
CACTTCTCGGCCATGGAGGAGCCGGACCTGTTCGTCGACGACCTGCGCACCTTCAACCGG
ACACTCAAGAAGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000639 Epoxide hydrolase-like (Family)
 [96-114]  1.49999977583352e-08 PR00412 [125-140]  1.49999977583352e-08 PR00412 [356-378]  1.49999977583352e-08 PR00412
PR00412   EPOXHYDRLASE
IPR010497 Epoxide hydrolase, N-terminal (Domain)
 [2-109]  7.20000000000002e-39 PF06441
PF06441   EHN
IPR016292 Epoxide hydrolase (Family)
 [1-385]  2.0000139277205e-82 PIRSF001112
PIRSF001112   Epoxide_hydrolase
SignalP No significant hit
TMHMM No significant hit