close all open/close all

CDS information : Ncarz_00170


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction35,190 / 34,420 / - [in whole cluster]
35,190 / 34,420 / - [in contig]
Locationcomplement(34420..35190) [in whole cluster]
complement(34420..35190) [in contig]
TypeCDS
Length771 bp (256 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)esterase/hydrolase
GenencsB4
orf27
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[17539640] Characterization of NcsB2 as a promiscuous naphthoic acid/coenzyme A ligase integral to the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin. (J Am Chem Soc. , 2007)

close this sectionSequence

selected fasta
>hypothetical protein [esterase/hydrolase]
MVSADGTTIAYEKSGSGPPVVIIGGGLNDKAMFTPLAQSLSQQFTVFNYDRRGRGGSGYG
DPEQYTIDREVEDLVAVLDAIGEPGHVFANCSGGMIAIHAAAAGVPMAKLGLYEPPYSSP
PLNGDEVDRLKALLAEDRREEAVTLFGKEIVKFMTDETLERFKQHPAWQAFESMAPSCVY
DAIINDRYGSIPHALLPKIAVETLVLSGSESAPWIQEACVTLSEEIPRARLLRIEGEGHL
FNQQTGAPLLVKFFGE
selected fasta
>hypothetical protein [esterase/hydrolase]
GTGGTGTCGGCCGACGGCACCACGATCGCCTACGAGAAGTCGGGAAGCGGCCCGCCCGTC
GTCATCATCGGGGGCGGGCTCAACGACAAGGCCATGTTCACACCGCTCGCCCAGAGCCTG
TCCCAGCAGTTCACGGTGTTCAACTACGATCGCCGCGGCCGTGGGGGTAGCGGCTACGGG
GACCCGGAGCAGTACACGATCGACCGTGAGGTCGAGGACCTGGTCGCCGTGCTCGACGCC
ATCGGGGAACCGGGCCACGTCTTCGCCAACTGCAGCGGCGGCATGATCGCCATCCATGCC
GCGGCGGCCGGCGTCCCCATGGCGAAACTGGGGCTCTACGAACCGCCGTACTCCTCGCCC
CCGCTCAACGGTGACGAGGTCGACCGGTTGAAGGCGCTCCTCGCCGAGGACCGCCGCGAA
GAGGCGGTGACCCTCTTCGGCAAGGAAATCGTCAAGTTCATGACGGACGAGACGCTGGAG
AGGTTCAAGCAGCACCCTGCCTGGCAGGCGTTCGAGTCCATGGCGCCCTCGTGTGTCTAC
GACGCGATCATCAACGACCGGTACGGTTCCATCCCTCACGCGCTGCTGCCGAAGATCGCT
GTCGAGACGCTGGTCCTCAGCGGCTCCGAGAGCGCGCCGTGGATCCAGGAGGCCTGCGTG
ACGCTCTCCGAGGAGATCCCCCGGGCCCGTCTGCTGCGCATCGAAGGCGAAGGGCACCTG
TTCAACCAGCAGACGGGTGCACCGCTGCTGGTGAAGTTCTTCGGGGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit