close all open/close all

CDS information : Ncarz_00180


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction36,622 / 35,390 / - [in whole cluster]
36,622 / 35,390 / - [in contig]
Locationcomplement(35390..36622) [in whole cluster]
complement(35390..36622) [in contig]
TypeCDS
Length1,233 bp (410 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productcytochrome P450
Product (GenBank)cytochrome P-450
GenencsB3
Gene (GenBank)
EC number
Keyword
  • naphthoic acid
  • C-7 hydroxylate
Note
Note (GenBank)
Reference
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)
[20735485] In vivo characterization of NcsB3 to establish the complete biosynthesis of the naphthoic acid moiety of the neocarzinostatin chromophore. (FEMS Microbiol Lett. , 2010)

close this sectionSequence

selected fasta
>cytochrome P450 [cytochrome P-450]
MCPYRLDPEGADTHGETARLREQGPIARVELQDGVLAWSVHDYAVAKQIMADERFSKNPR
KNWPAYINGEISNGWPLITWVAMDTMATQDGADHARLRKLLLKAFTERRVESMRPHIEKT
VKELLDNMAAKADDEIVDIKEMFHAELPTRLMCDLFGVPEERRAEVLAGGHKNIDTRISS
EAAEANLGQWQEAISDLVEYKRHHPGDDLTSALIEARDEGSRLSDSELIGTLHLLLGAGS
ETLVNALAHSSLALLVDADLRKKVTSGEIPWVNVWEETLRVESPVAHLPFRYATEDFEIG
GVKISKGDPLLVDFAGIGRDPAVHSDAPDEFDALRPDKTHLSFGHGVHYCLGARLAKHAW
MIGIPALFERFPDMELAVRRDELKGQGSFVVNGHASLPVHLKGRAAALAR
selected fasta
>cytochrome P450 [cytochrome P-450]
GTGTGCCCTTACCGTCTTGACCCCGAGGGCGCCGACACCCACGGGGAGACCGCTCGTCTG
CGCGAGCAGGGCCCGATCGCACGGGTCGAACTCCAGGACGGCGTGCTTGCGTGGTCGGTG
CACGACTACGCGGTCGCCAAGCAGATCATGGCCGACGAGCGCTTCTCCAAGAACCCCCGC
AAGAACTGGCCCGCGTACATCAACGGGGAGATATCGAACGGCTGGCCCCTGATCACCTGG
GTGGCCATGGACACCATGGCCACCCAGGACGGCGCCGACCACGCACGTCTGCGCAAGCTG
CTCCTGAAGGCCTTCACCGAGCGTCGTGTCGAGTCCATGAGGCCGCACATCGAAAAGACG
GTGAAGGAACTCCTCGACAACATGGCCGCCAAGGCCGACGACGAGATCGTGGACATCAAG
GAGATGTTCCACGCCGAGCTGCCCACGCGGCTGATGTGCGACCTCTTCGGTGTGCCGGAG
GAGAGGCGCGCCGAGGTGCTGGCGGGGGGACACAAGAACATCGACACCCGGATCTCCTCC
GAGGCGGCGGAAGCCAACCTCGGGCAGTGGCAGGAAGCCATCTCCGATCTCGTCGAGTAC
AAGCGTCATCACCCCGGTGACGACCTCACGAGTGCACTGATCGAGGCCAGGGACGAGGGT
TCGCGGCTGAGTGACTCGGAGCTGATCGGCACGCTGCACCTGCTGCTCGGCGCCGGCTCC
GAGACTCTGGTGAATGCCCTCGCCCACTCCTCCCTGGCCCTGCTCGTCGACGCCGACCTG
CGCAAGAAGGTGACCTCTGGCGAGATCCCCTGGGTGAACGTCTGGGAGGAGACGCTGCGA
GTGGAGTCGCCCGTGGCACACCTGCCCTTCCGCTACGCGACGGAGGACTTCGAGATCGGC
GGTGTGAAGATCTCGAAGGGCGATCCCCTGCTGGTCGACTTCGCGGGCATCGGCCGGGAC
CCTGCCGTACACAGCGATGCCCCCGACGAGTTTGACGCTCTCCGGCCCGACAAGACGCAC
CTCTCGTTCGGCCACGGCGTCCACTACTGCCTCGGCGCGCGGCTCGCGAAGCACGCCTGG
ATGATCGGCATCCCCGCATTGTTCGAGCGCTTCCCCGACATGGAACTCGCGGTCCGCCGT
GACGAACTCAAGGGGCAGGGAAGCTTCGTGGTCAACGGCCATGCCAGTCTGCCGGTGCAC
CTGAAGGGCCGGGCCGCGGCTCTCGCCCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [10-404]  2.59999999999995e-94 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [274-371]  1.8e-14 PF00067
PF00067   p450
 [11-404]  2.1000026783403e-87 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [89-100]  1.70000295590054e-30 PR00359 [138-154]  1.70000295590054e-30 PR00359 [155-170]  1.70000295590054e-30 PR00359 [192-214]  1.70000295590054e-30 PR00359 [273-284]  1.70000295590054e-30 PR00359 [291-318]  1.70000295590054e-30 PR00359 [341-350]  1.70000295590054e-30 PR00359 [350-361]  1.70000295590054e-30 PR00359
PR00359   BP450
IPR017972 Cytochrome P450, conserved site (Conserved_site)
 [343-352]  PS00086
PS00086   CYTOCHROME_P450
SignalP No significant hit
TMHMM No significant hit