close all open/close all

CDS information : Ncarz_00190


close this sectionLocation

Organism
StrainATCC 15944
Entry nameNeocarzinostatin
Contig
Start / Stop / Direction37,308 / 36,937 / - [in whole cluster]
37,308 / 36,937 / - [in contig]
Locationcomplement(36937..37308) [in whole cluster]
complement(36937..37308) [in contig]
TypeCDS
Length372 bp (123 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hydroxylase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[15797213] The neocarzinostatin biosynthetic gene cluster from Streptomyces carzinostaticus ATCC 15944 involving two iterative type I polyketide synthases. (Chem Biol. , 2005)

close this sectionSequence

selected fasta
>hypothetical protein [hydroxylase]
MANEKEKTNFPAVPGWFDISTPDSSQTRAFYQEIFGWTINALDDTYAMVSSGDGPPSGGI
GQAGPESPYVGVVPYFPVADVEAALAQAEKLGGSVKMPPQDTPAGRIAVFTDPDGNNVGV
MSS
selected fasta
>hypothetical protein [hydroxylase]
ATGGCAAACGAAAAAGAAAAGACCAATTTTCCCGCCGTGCCTGGCTGGTTCGACATCTCC
ACCCCTGACTCGTCCCAGACGCGGGCTTTCTACCAGGAAATCTTCGGCTGGACGATCAAT
GCCCTGGACGACACCTATGCCATGGTGAGCTCCGGGGACGGCCCGCCCTCCGGAGGAATC
GGTCAGGCCGGCCCCGAGAGCCCGTATGTCGGGGTCGTTCCCTATTTCCCGGTTGCCGAC
GTCGAGGCAGCCCTCGCGCAGGCGGAGAAGCTCGGCGGCTCCGTGAAGATGCCGCCGCAG
GACACCCCTGCCGGCCGTATCGCCGTCTTCACTGACCCCGACGGCAACAACGTCGGAGTC
ATGAGTTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025870 Glyoxalase-like domain (Domain)
 [19-120]  9.9e-20 PF12681
PF12681   Glyoxalase_2
SignalP No significant hit
TMHMM No significant hit